CAZyme Information: SMAC_09915-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09915-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		36983.05	4.7321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003545386:661-1707(+)

Full Sequence      

MTRDGDWFVAEVAGVGPGQLYGYRADGEWDPDHGRWFDPAKLLVDPYAIELDRRFAYDPT
LSTFGIDTAAIVPRAIVPALVQPVAFERPRIDPARPIYELNVRGFTMLHPDVPETQRGTI
AALAHPSVIAHLRKIGVGTVELMPIVAWIDERHLPPLGLSNAWGYNPIAMMAIDPGLAPG
GVAELRDTIAALHAADIGVILDVVFNHSGESDVHGPILSLRGLDDRCYAHAPDGGLINDT
GTGNTLDAGDAGVRDLILASLRHFASLGVDGFRFDLAPVIARSPGFVAQAPIFAAIAADP
VLADRVMIASHGISARADISWEIFRLTGWNGTTGIATTSAGSGEGMAA

Enzyme Prediction     

EC	3.2.1.68:75	2.4.1.25:4	3.2.1.-:1	3.2.1.68:15	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	117	311	7e-58	0.5726495726495726

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224440	PulA	1.53e-114	3	309	66	394	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
200465	AmyAc_Glg_debranch	2.79e-106	88	309	8	240	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
235152	PRK03705	3.20e-101	3	309	52	370	glycogen debranching protein GlgX.
237739	PRK14510	1.64e-95	3	314	58	389	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
200484	AmyAc_plant_IsoA	1.38e-34	97	329	7	237	Alpha amylase catalytic domain family found in plant isoamylases. Two types of debranching enzymes exist in plants: isoamylase-type (EC 3.2.1.68) and a pullulanase-type (EC 3.2.1.41, also known as limit-dextrinase). These efficiently hydrolyze alpha-(1,6)-linkages in amylopectin and pullulan. This group does not contain the conserved catalytic triad present in other alpha-amylase-like proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCI95449.1|CBM48|GH13_11	1.27e-153	1	309	33	342
QOV92916.1|CBM48|GH13_11	5.30e-148	1	309	39	347
AXU19441.1|CBM48|GH13_11	1.21e-146	1	309	39	347
QIG55306.1|CBM48|GH13_11	2.65e-146	1	309	37	346
AOL93848.1|CBM48|GH13_11	6.50e-145	1	309	41	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WSK_A	1.86e-70	3	309	52	370	Crystal structure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
2VNC_A	2.06e-53	2	309	64	398	Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	1.05e-30	1	283	113	425	Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
1BF2_A	1.00e-24	11	291	67	394	Structure Of Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
3WDH_A	1.68e-16	97	280	224	418	Crystal structure of Pullulanase from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDI_A Crystal structure of Pullulanase complexed with maltotriose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11],3WDJ_A Crystal structure of Pullulanase complexed with maltotetraose from Anoxybacillus sp. LM18-11 [Anoxybacillus sp. LM18-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1JSI8|GLGX_YERE8	1.85e-77	2	309	51	372	Glycogen debranching enzyme OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=glgX PE=3 SV=1
sp|B2K6G0|GLGX_YERPB	6.10e-74	2	309	51	372	Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=glgX PE=3 SV=1
sp|A7FNX4|GLGX_YERP3	1.20e-73	2	309	51	372	Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=glgX PE=3 SV=1
sp|Q664I3|GLGX_YERPS	1.68e-73	2	309	51	372	Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=glgX PE=3 SV=1
sp|B1JHX8|GLGX_YERPY	1.68e-73	2	309	51	372	Glycogen debranching enzyme OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=glgX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999340	0.000709

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09915-t26_1-p1.