CAZyme Information: SMAC_09599-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09599-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		47802.95	6.5744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003545822:2459-3903(-)

Full Sequence      

MLSSAYALVLAVGLVTAGTIPGRRGPVLEARDGSLPSLPYDPNTTSSCTWWADIRSATTC
DDIISENFISLAKLTQWNPSISATSCSVEIGKSYCVEAPYVEPAPGTSISSTKAATSPMS
STATSSSSASTTVVPPVTTTAPGNGITTPTPTQASIVDNCDAFHFVTAGQTCEVIASLYG
ISQDQFKEWNPSVGASCTGLWANAYACVSIIGHTPTKPTTTTTTTGNGIATPTPTQASIV
NNCDAFYFVVAGDTCEAIAAKNGITQAQFLSWNPSVGSTCNGLWANAYACVSIVGHTPTK
PTTTTTTTTTSVGNGIATPTPVQPNMVKNCDLFYKVKSGDTCATIAAAKGVTVAQLTTWN
PYVKSDCSLLWVDYNICISIVGHTPTPVKPGNGIQTPTPIQSGMTTSCRTFHFVTSGQTC
QTIIAKYGITQANFVKWNPAVKSDCTGMWANAYVCVAVL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.17e-10	333	376	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	1.61e-09	333	378	1	44	Lysin motif.
212030	LysM	7.44e-09	246	284	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	8.45e-07	163	201	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	2.07e-06	226	444	310	513	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80752.1|CBM50	5.46e-257	1	459	1	436
VBB80356.1|CBM50	9.56e-233	1	459	1	458
CZS72050.1|CBM50	7.33e-119	14	459	8	440
CEF84338.1|CBM50	1.04e-118	14	459	8	440
CAE7022339.1|CBM50	3.75e-116	36	459	30	451

PDB Hits     

SMAC_09599-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	6.07e-141	8	459	9	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	3.63e-16	253	387	39	188	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.16e-14	243	458	262	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	2.30e-14	149	293	254	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|P37710|ALYS_ENTFA	1.24e-10	143	438	342	593	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999715	CS pos: 17-18. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09599-t26_1-p1.