CAZyme Information: SMAC_09305-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09305-t26_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		52380.31	4.6532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546155:16400-17929(-)

Full Sequence      

MKTNRVAKAALAVGLSATALAQSCDKVLVPSYDLPVVAAGWQAQLIAGELTKPRSLQFDS
SGALLVVESGKGITRHTLKDNGGTCISVSESKTLIDEKTLNHGIALSKDGKILYASSASA
VYAWDYDSKAGTVSGKREIVTNMSNNDLVTRTLLLSQKEDGYLLVSRGSADGNEAQAEVL
NNGLSQIRAFDISNLTSSTKAYNYNEDGIVLGWGLRNSVGVGEHPVTGGIYAVENSIDGV
TRNGKDIHENNPGEELNFFGYLNGTTNGQGRNYGYPKCFAVWDVSEIPENDNLKIGSQFA
ITEEENAQTVSGNKLTDETCASDYVAPRLTFPAHYAPIDIKFSPQKGDVAYVTFRGSFDK
KNPVGYRLSSIQFDPATGEPTVSAENGRDALKDIIVNKDNSVCPDKCFRPVGLAFDSEER
LWMTSDSTGEIYVLLKTASSTENGTIVTGTDGPESSPSATGEDENAAGRLLGTRGAWLWA
GVVGVAGALALI

Enzyme Prediction     

No EC number prediction in SMAC_09305-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	25	434	2.1e-178	0.9950124688279302

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	3.47e-18	3	357	4	341	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
225921	YvrE	0.003	103	140	167	206	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA30888.1|AA12	3.08e-296	1	492	1	516
VBB80430.1|AA12	2.79e-190	16	465	14	453
CDP28783.1|AA12	5.31e-181	16	485	14	482
CAP67040.1|AA12	4.41e-165	16	485	14	483
QDS74351.1|AA12	7.32e-156	12	445	10	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	5.08e-130	31	434	7	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	5.25e-130	31	434	8	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	5.43e-130	31	434	9	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	4.13e-67	23	434	4	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

SMAC_09305-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008264	0.991712	CS pos: 21-22. Pr: 0.7928

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09305-t26_1-p1.