CAZyme Information: SMAC_09293-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09293-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	NW_003546204|CGC1	28356.58	6.1050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546204:25066-25824(+)

Full Sequence      

MGIRHMLIAALAAVAPIVQGAQIFSNHGTLSGWDGQQTENKGKISEVTNLVYEGGTALKF
EQTYDSSYSGRYHAEVRTLNGYARGETRFYGFVFRLQGDWQSSPAQSYNIAQFIGNFGSS
SCDEWSPTSMIWVKGNRLMTRVKSGTLCSPQTTSFDTGIDVTGGVWHKIVMQVKWRSDST
GYFKLWYDGTKVVEQRDIKTTLDTDVRFQFRVGLYANAWYDSGYAGTQPFRQVWFDEIAI
GDTFADADPDQW

Enzyme Prediction     

EC	4.2.2.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL20	24	252	5.6e-109	0.9956331877729258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404905	Polysacc_lyase	2.85e-80	26	239	2	213	Polysaccharide lyase. This family includes heparin lyase I, EC:4.2.2.7. Heparin lyase I depolymerizes heparin by cleaving the glycosidic linkage next to an iduronic acid moiety. The structure of heparin lyase I consists of a beta-jelly roll domain with a long, deep substrate-binding groove and an unusual thumb domain containing many basic residues extending from the main body of the enzyme. This family also includes glucuronan lyase, EC:4.2.2.14. The structure glucuronan lyase is a beta-jelly roll.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA30607.1|PL20	2.80e-177	1	252	1	253
BAV32165.1|PL20	8.40e-106	1	252	1	257
AKF87377.1|PL20	1.97e-105	15	252	4	241
AGC46986.1|PL20	9.09e-105	10	252	13	255
QKW93669.1|PL20	1.83e-104	10	252	13	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZZJ_A	4.48e-90	24	251	4	237	Chain A, Glucuronan lyase A [Trichoderma reesei]

Swiss-Prot Hits     

SMAC_09293-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999769	CS pos: 20-21. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09293-t26_1-p1.