CAZyme Information: SMAC_09244-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09244-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		63442.45	9.5796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546117:19972-21986(+)

Full Sequence      

MAKLSKVVFLWKVLSIPLATAYPQLQNEFKQRAVKPSEIKGSYDYVIIGGGQSGLVVANR
LSEDPKVSVLVVEYGYFDDSYDVLDIQKVFRDTTHTKYNLTSVPQTQLGEANQVQSVPAA
AVVGGGSAINGMFFNRGAADDYDNWEKLGNPGWGFNGLLPYFIKSTTLQIPDAAFAKEFN
ATWDEKVYGKNGPIQASIYPVQYPALKSVWTGFEELGAERQKSGDDGNAHGLFWATRSID
DRTRTRSYARTGYYAPVAERKNLDLLTGWRVNTITFDKKKQATGINMQSRDSITDAKAKI
TSIKARKEVILAAGALHTPQILQRSGVGPASLLQKANVPLVIDLPGVGANMQDHPQVTMI
VALLPLSLVSPANYTSLAKSYLSQSSAAYLPASYSAATLKAGYAKQQKLLGSSLLRKDNA
ALEMPFAGNGGYYLLMLTKPVSRGTININTSNPYAEPLVDFNTFGNPADLAIAMEAFKFG
RVLHNTKTISSTFHPVELAPGAQVASEKDLEKAARDTVVSTTAHLSGTASLMPRELGGVV
DTELKVYGVKGVRVVDASVMPLIPGAHLCSTVYAVAEKAADLIKGRK

Enzyme Prediction     

No EC number prediction in SMAC_09244-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	42	584	7.7e-165	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.42e-88	42	587	5	535	choline dehydrogenase; Validated
225186	BetA	4.45e-86	36	587	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.15e-35	440	579	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.91e-29	19	572	37	565	Protein HOTHEAD
366272	GMC_oxred_N	6.41e-29	117	355	21	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43942.1|AA3_2|CBM1	1.35e-162	21	586	23	621
QRD00954.1|AA3_2	5.82e-142	42	586	24	604
SMY23609.1|AA3_2	6.67e-132	13	586	10	621
SMR50915.1|AA3_2	9.41e-132	13	586	10	621
SMR51855.1|AA3_2	9.41e-132	13	586	10	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.12e-106	39	584	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.65e-97	37	583	30	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	2.91e-72	42	584	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	9.63e-59	36	584	9	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6ZH7_A	1.32e-54	37	586	2	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	9.90e-100	1	585	1	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.76e-82	42	585	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.76e-82	42	585	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.32e-76	34	584	30	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.69e-62	39	584	10	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.115333	0.884625	CS pos: 21-22. Pr: 0.8441

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09244-t26_1-p1.