CAZyme Information: SMAC_09243-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09243-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		69266.88	9.6003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546117:14866-16870(+)

Full Sequence      

MAKLSKTVLLWRLLLVPLAAAYPQLQAELRHRTIKPEDTKGAYDYIIVGGGQSGLVVANR
LSEDPKVSVLVVEYGYFDNSYDVLDHNNIFRDTTAWEYNITSVAQTGLGEANRFQKIRSA
AVVGGGSAINGMFFNRGSAEDYDDWEKLGNPGWGFNGLLPYFRKSQTLQTPNPNLARDFN
VTWDSTAFGNGPIQASIYPVQYPEVGKWYQGFVEAGLEPQQSGDNGHAHGLFWSTVSVIN
LSLDGKKRSNKRQRAVDDRTRTRSYARNQYYDPIKDRKNLDLLTGWRVNTVKFDKNKQVT
GIVMQPRDSINDPKAKTTTIKAKKEVVLSSGAYHTPQILQRSGIGPASHLKKANIPVLVD
LPGVGSNLQDHAVVSMYYQYTNAKPLPPPPAEGPYPVMANSVALLPVKDMAPSSYLSIAR
DYLAQQIEKVLPESYTKEQKAGYLKQRELLAADMKKKTAAFVEIPFTGNDPLYIMVQMKP
VSRGTVMLNTTDIYAEPVVDFRTFFNPVDVAIARESLKFVRDILHKTPSFQSLGPLELDP
GLGVAGDEALDNRVRSNAGSTTAHQSGTAAMMPRELGGVVDSQLRVYGVRGLRVVDTSIM
PLVPAAHTCSSTYAVAEKGADLIKGRKM

Enzyme Prediction     

No EC number prediction in SMAC_09243-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	42	624	5.6e-155	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.90e-98	43	628	6	536	choline dehydrogenase; Validated
225186	BetA	9.96e-82	36	628	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.89e-38	480	618	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.86e-27	112	373	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.27e-19	22	599	31	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43942.1|AA3_2|CBM1	3.36e-166	21	626	23	621
UQC77231.1|AA3_2	9.98e-125	16	624	20	621
QRD00954.1|AA3_2	2.47e-124	43	626	25	604
SMY23609.1|AA3_2	7.73e-123	36	626	37	621
SMR50915.1|AA3_2	1.09e-122	36	626	37	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	7.17e-106	43	624	6	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	3.43e-98	19	623	17	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.06e-70	43	624	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	5.00e-55	43	624	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	1.75e-50	43	624	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.50e-102	1	625	1	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.82e-76	42	625	46	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.82e-76	42	625	46	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.22e-68	44	624	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A9AMZ9|BETA_BURM1	5.05e-59	39	627	2	536	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000713	0.999272	CS pos: 21-22. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09243-t26_1-p1.