CAZyme Information: SMAC_09232-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09232-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577	NW_003546173|CGC2	64855.93	6.0510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546173:41386-43331(-)

Full Sequence      

MARFPSAIPRQLRPSRRRHVFLALALLFTLAYFLHFSSSSLDDTSPPTHGSEFAWLQHHM
NAPLKTQTQTQQNSHPTPPSTGPPSRPSTPPPSLSANCPSVDQSLYHPSNTVSVQNPPQL
AKPAKPVAKKSSLRQEFDEAVAAVADIDFGVTKDGSGRVNIFETNIRYLGGLLAAYDLSG
REVLLTKARELGDLLYAGFNTAERMPVDFIDFERAKMGEGLIVEGSVVSASPGTLTLEMT
RLSQVTGDMKYYDAAARVMDVFEQGQNFTRVPGLWPIYVSMARKDVTNGNQFGVAGCADS
LYEYLPKMYALTGGLEPRYESMSRAFLEAADKALFFRPMLPGNEDVLMIGTADVTVDEKE
DMVLIPESEHLGCFVGGIYGLSGKLFRRPEWVESQGVKITNGCVYAYRAMPTGMMPERYN
MVPCQSRDDKSCKWNEELWEREKRKRPEWKEHLPKGFTTAKDPRYILRPEAIESVFVMWR
ITGKQEFQEAAWDMFEAVSIGTETDFANAAVLDVTKAEYPLPKEDYMESFWLAETLKYFY
LAFSPPDVISLDDFVLNTEAHPFRRPKKPRVDRPLKV

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	133	565	6.2e-125	0.8878923766816144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.99e-166	133	565	49	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.06e-98	133	569	126	522	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	2.82e-05	167	262	472	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA29739.2|GH47	2.10e-240	1	577	1	602
UKZ82405.1|GH47	2.29e-209	133	567	142	569
UQC90072.1|GH47	7.98e-208	133	565	164	589
QYT04436.1|GH47	2.12e-207	133	567	162	589
UKZ95051.1|GH47	1.54e-204	133	567	161	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	8.04e-41	144	562	71	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.42e-40	144	562	106	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1NXC_A	1.59e-40	133	572	78	474	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	2.58e-40	133	563	80	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
5KIJ_A	9.40e-40	133	562	59	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C512|MNS1_ARATH	5.64e-47	133	571	152	547	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	1.64e-45	133	564	153	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q8J0Q0|MNS1_CANAX	1.71e-43	158	565	116	508	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|D4AV26|MNS1B_ARTBC	4.89e-43	144	564	106	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q5BF93|MNS1B_EMENI	6.29e-43	144	564	99	500	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000007

TMHMM  Annotations     

Start	End
20	37