CAZyme Information: SMAC_09229-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_09229-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	NW_003546173|CGC2	68069.14	4.8806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546173:29107-31066(-)

Full Sequence      

MKFSFLSLLLAPALAAAAGTAEEANPTTTTYDYIVVGSGPGGGPLSAELARAGYSTLLIE
AGTDQWDNPTYADIQNFNEAANDETTRWDFWVKHSDDAARDLKFKHTTWDTGDGTFYVGL
DPPEGAKLLGIQYPRAAVLGGCAMHNAGVASLPEDDDWNRIVNLTGDASWEAGKMREYLK
KIERNEYADKGDASHGHDGWLAISNTDPSWAKNDSNPGVKIMKRIAELIGQDPSQVAELA
NTDVLGDFPQRDTMSSFFNMATHADKNGKRYSPNNYIRATLADPAKYPLTVKLNTLATKV
LFNTTGQKPRAVGIEVMEGPSLYRADPKHVAGSPAPPKTQYFARREVILSGGAFNTPQLL
KLSGIGPASELSQFQIPVLVDLPGVGEGLTDNYEGSILGLGKVPIESGLITLLFRTPNAP
TKKRNIYAWCGAFSFEGFWPGYPTYYGAEQFTCAMVHVKPRSQDGSVRLLSKDPRDKPDI
NFRFFEHGGDEDLAELVSAANILRESWQAAGDSVTPFQELHPCPATSQSANSTCSRVEEA
EFFKTQAYSHHATSSCQIGGDGDKMAVLDSKFRVRGTEGLRVVDASAFPNVPGFFPSVPT
MMISVKAAGDVLEAARAADADADAGKGVEE

Enzyme Prediction     

No EC number prediction in SMAC_09229-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	614	6.5e-72	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.14e-49	266	608	195	528	choline dehydrogenase; Validated
225186	BetA	3.22e-45	47	608	24	530	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.04e-28	460	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.75e-25	265	603	215	568	Protein HOTHEAD
366272	GMC_oxred_N	4.82e-11	266	394	122	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81166.1|AA3	3.33e-297	1	622	1	621
CAP64871.1|AA3	4.73e-297	1	622	1	621
CDP29384.1|AA3	4.73e-297	1	622	1	621
QBZ53739.1|AA3	4.50e-225	14	612	68	659
QRD01027.1|AA3	6.70e-199	1	612	5	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	2.26e-42	25	619	8	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	2.26e-42	25	619	8	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	5.76e-42	25	619	8	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	4.24e-27	27	612	2	528	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	5.68e-27	27	612	2	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.97e-41	25	619	8	533	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.10e-35	29	612	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	9.66e-33	32	612	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|B4SHV9|BETA_STRM5	1.95e-32	27	608	3	532	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=betA PE=3 SV=1
sp|B2FQ89|BETA_STRMK	4.78e-32	27	608	3	532	Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005943	0.994017	CS pos: 17-18. Pr: 0.9263

TMHMM  Annotations     

There is no transmembrane helices in SMAC_09229-t26_1-p1.