CAZyme Information: SMAC_08989-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_08989-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		25877.66	7.2912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546136:18550-19567(-)

Full Sequence      

MFFSNLLLSALALASAALASPIELAERQTPQKLRIMPLGDSITEITCWRATVWDQLASAN
LASSVQYVGSQNSNPQNCKPATANWDQHHEGHSGWLAVDIANNYLEGWLKKTPADIVMFM
LGTNDVTRGKSTQDVINAYTKMVGIMRASNPKVKIIVDLIIPLSFSNNAIQAINAQIPSW
AAKMNTTESPIVIADCYTGFKTSDLRDGVHPNANGDKIIAERVGPLLLDFVRQGLAGK

Enzyme Prediction     

No EC number prediction in SMAC_08989-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	33	221	1.6e-58	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.69e-48	33	225	1	155	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.89e-17	38	215	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.46e-14	38	226	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	1.22e-10	111	215	46	156	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	3.16e-10	38	235	14	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59370.1|CE3	3.61e-124	9	235	8	233
AEO64701.1|CE3	7.70e-119	8	236	7	235
VBB79507.1|CE3	1.39e-116	4	238	63	294
CDP27869.1|CE3	1.39e-116	4	238	63	294
CAP61514.1|CE3	1.39e-116	4	238	63	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.90e-68	33	232	2	204	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	5.42e-68	33	232	2	204	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

SMAC_08989-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999741	CS pos: 27-28. Pr: 0.8733

TMHMM  Annotations     

There is no transmembrane helices in SMAC_08989-t26_1-p1.