CAZyme Information: SMAC_08680-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_08680-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		25667.53	7.5512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546198:42873-43814(+)

Full Sequence      

MRSSTILQTCLVAVLPFAVQAASGSGKSTRYWDCCKPSCAWSGKASVNRPVLACDSNNNP
LSDTNVNLTFTSGPVSGKTLVVQSTSTGGDLGSNHFDLNMPGGGVGLFDGCKREFGGLPG
AQYGGISSRSECDSFPAPLKPGCQWRFDWFKNADNPEFTFKQVQCPSELTSRTGCKRNDD
SQFPAFTPPSGGGSNPSTPTTPPPSGGGSGCTAAMYAQCGGSGFSGCTNCPSGLTCKAIN
DYYHQCA

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	66	176	2.7e-46	0.5707070707070707

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.07e-58	25	176	1	214	Glycosyl hydrolase family 45.
395595	CBM_1	1.09e-09	215	243	1	29	Fungal cellulose binding domain.
197593	fCBD	2.43e-08	216	246	3	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27871.1|CBM1|GH45|3.2.1.4	3.48e-154	1	247	1	293
CAD70529.1|CBM1|GH45|3.2.1.4	3.48e-154	1	247	1	293
AAY00849.1|CBM1|GH45	3.20e-121	1	246	1	298
CAH03187.1|CBM1|GH45	3.20e-121	1	246	1	298
AEO64667.1|CBM1|GH45|3.2.1.4	3.20e-121	1	246	1	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.20e-155	1	247	1	293	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	1.04e-93	22	188	1	213	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.19e-93	22	188	4	216	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1OA7_A	1.70e-85	25	190	2	213	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1L8F_A	8.95e-84	25	183	2	206	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	2.30e-84	1	186	1	230	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	2.63e-81	26	189	3	213	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	5.10e-56	11	177	7	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	2.52e-32	23	175	37	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	1.32e-28	25	187	26	246	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999780	CS pos: 21-22. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in SMAC_08680-t26_1-p1.