CAZyme Information: SMAC_08194-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_08194-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		30773.10	8.4452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546232:132408-133344(-)

Full Sequence      

MLAKTLFGLALTAATGLCASLQQVTNWGSNPTKIQMYTYVPDKLAAKPAIIVAMHACGGT
APSWYSGTRLPSYADQNGFILIYPGTPNMSNCWGVHDPASLTHGAGGDSLGIVAMVNYTI
AKYNADASRVYLMGTSSGGMMTNVLAGTYPEVFEAGAAYSGVAHACFAGAASATPFSANQ
TCAKGLQHTPQEWGNFVRNSYPGYTGRRPRMQIIHGAADTLVNARCAMEALKQWSNVLGV
EFSKNVTGVPSQAYTQIVYGDGTKLVGYMGAGVGHVAPTNEQVMLKFFGLIN

Enzyme Prediction     

No EC number prediction in SMAC_08194-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	191	6.4e-23	0.6035242290748899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	3.04e-41	36	248	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.22e-22	1	278	16	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.60e-21	39	227	6	188	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	5.43e-09	64	222	1	158	Prolyl oligopeptidase family.
224423	DAP2	1.80e-05	36	162	382	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE75726.1|CE1	2.94e-201	1	292	1	292
CAC05587.1|CE1	1.70e-200	1	292	1	292
QBZ57428.1|CE1	2.21e-157	4	291	4	291
AFU88756.1|CE1	3.13e-157	1	292	1	292
VBB78227.1|CE1	1.34e-151	1	291	1	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	5.03e-78	20	289	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	5.23e-202	1	292	1	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	1.98e-146	1	291	1	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	3.60e-102	9	290	9	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	4.98e-101	17	290	17	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|A1DBP9|AXE1_NEOFI	3.43e-78	20	289	33	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.114183	0.885796	CS pos: 18-19. Pr: 0.7058

TMHMM  Annotations     

There is no transmembrane helices in SMAC_08194-t26_1-p1.