CAZyme Information: SMAC_08072-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_08072-t26_1-p1
• CAZy Family: GH75
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885		98210.09	5.4660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546201:154879-157821(-)

Full Sequence      

MTSLSSIAVRGGPFERDIDPNASPSESIDSNTTPDTEFSPMGSPFQEVAVPKNKRFLAKK
KLASLTQEEKISLLTAADFWRTKSIPEKNIPAVKTSDGPNGARGGIFVGGTKAALFPCGI
SLAATWNKALLREVGRHLAEEAKARQANILLAPTVCMHRHPLGGRNFESFSEDPLLTGKL
AAQYIKGLQENGVAATIKHFVGNEQETNRLTVNSVIAERPLREIYLRPFEIAVREAKPWA
VMSSYNLVNGVHADMNTHTLKEVLRDEWKFDGAVISDWGGVNSTAESIKAGCDIEFPHSK
KWRYENVIEALNKGELSQADIDRAAENVLTLVERTKGSDLTPETAEKEDDREETRELIRE
AGIQGLTLLKNEGSILPINPKTTKVAVIGPNANRAIAGGGGSASLNPYYTTLPLESIRKV
AEKPVTYAQGCHIYKWLPVASPYCSDKTGKPGVTIEWFKGDKFKGEPVTIQRRTNTDLFL
WDSAPLAQTGPEWSAVATTYLTPKHSGKHTISYMSVGPGKLYINGKLSLDLWDWTEEGEA
MFDGSVDYLVEVEMDANRPVELRIEMTNELRPLTKQKQMGMTHRYGGCRIGFKEEDQVDY
LQEAIDAASAADVAIVVVGLDAEWESEGYDRQTMDLPYNGSQDRLVEAVVKANPNTVIVN
QSGSPVTMPWADRVPTILQAWYQGQEAGNALADVLFGLRNPSGKLPCTFPKRLEDTPAYH
NWPGENLEVIYGEGIYIGYRHYDRSKIAPLFPFGHGLSYTSFEYGRPSLSSRVLTQNGVI
ELCVAITNVGEYDGAETVQVYVRDEKSRLPRPEKELVAFEKLQLEKSETRHLRIELDKYA
VGYYDTERKAWVAEEGRFLVLVGPSSGDIKYSVPFEVKQTFTWIF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	296	1.4e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.43e-94	116	870	120	758	beta-glucosidase BglX.
224389	BglX	2.28e-80	78	433	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.59e-66	366	739	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.74e-62	39	877	34	779	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.56e-48	90	331	66	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35798.3|GH3	0.0	1	870	1	870
VBB72333.1|GH3	0.0	19	885	22	908
AEO53892.1|GH3	0.0	8	885	6	884
CDP23238.1|GH3	0.0	19	871	22	896
CAP69216.1|GH3	0.0	19	871	22	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.70e-188	55	883	3	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.42e-183	55	883	3	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.36e-152	59	880	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.95e-118	65	869	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.13e-110	62	879	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	8.75e-226	62	873	15	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	9.16e-203	55	884	3	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.81e-199	59	884	7	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.19e-199	59	884	7	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	7.41e-199	55	884	3	837	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMAC_08072-t26_1-p1.