CAZyme Information: SMAC_07936-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07936-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		36307.72	5.6619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546227:148086-149126(-)

Full Sequence      

MTGESHYIGPLDSKHTDDGNSKWVNDMPHEGWMDLAKPFIAAYKAGASKPDAYISEDQII
YWYRPTLKSLNCDATDTTLQDANNSSGNYFKGRPNGYETMEDAVFVVSLLKTAGQIKVTS
GGNSAVTYQAPAGAFAQKIPMGVGKQRFELTRNGQSVLSGISSRDISSTCPCGIYNFNAF
VGVLPFKTFGSLDSQGLASLTAGLHVSTCQPTPTLIATAPPSDDPQPMNNPLSSSTPPSP
TTILTKTATTAPPVSTPTNCNGGTVANGESSNLAALCDFSCSQSYCPPGPCKCTSFGTPG
WSVTPTKPPGCPAPGLMTLTRDFVPSLAPETIALQVPARQTAASEN

Enzyme Prediction     

EC	3.2.1.59:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	3	159	1.6e-48	0.384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	5.89e-68	3	159	231	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	7.21e-15	3	46	238	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS95495.1|CBM24|GH71	3.80e-110	3	312	286	591
AEO61225.1|CBM24|GH71	4.65e-104	3	314	274	602
QGA15754.1|CBM24|GH71	4.66e-103	3	308	272	562
UNI15584.1|CBM24|GH71	1.45e-102	3	312	285	600
CAP91182.1|CBM24|GH71	3.93e-102	3	299	322	640

PDB Hits     

SMAC_07936-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GX22|MU71A_PENRW	6.95e-44	3	182	267	428	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O13716|AGN1_SCHPO	1.27e-20	3	186	261	424	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07936-t26_1-p1.