CAZyme Information: SMAC_07862-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07862-t26_1-p1
• CAZy Family: GH71|CBM24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		54501.36	8.4888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546158:26019-27670(-)

Full Sequence      

MWLPLILLTATAAPILANPLTSPLNKRAAIDDCLKSAGVPADAQGSSDWRADVNPFNQRL
PYTPVAIAVPTTVEHIQGAVSCAAKLGIKVTPKSGGHSYASFGLGGENGHLVVELDRMFK
VTLDKTTNIADIQAGARLGHVATELYKQGKRAFSHGTCPGVGVAGHSLHGGFGFSSHTYG
LAVDWIAAATVVLANSTVVTASPTENPDLFWALRGAGSNFGIVTSFKFNTFAAPSQVTAF
QINLPWNSASSIASGWGKLQDWLAAGNMPKEMNFRIFGSPSQTQIQGLYHGSSSALRTAA
QPLLSALGASLSNAQQYDWMGAFTYYTYGGTVDVTHPYNQVETFYSKSLVTTALPSAALN
SVASYWINTAKRVNRDWFIIIDMHGGPKSAITSTTTNSANYTSSYAYRSPEYLFLYELYD
RVQFGSYPSNGFSFLDGWVKSFTDNMKQDQWGMYINYADPTMKRAEAVGNYYRGSLERLK
QVKAQYDPNELFYYPQSVEPAK

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	55	498	4.9e-99	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	8.87e-27	61	492	29	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.81e-26	64	202	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	6.07e-13	454	499	2	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	3.47e-06	70	225	21	173	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB87167.1|AA7	3.68e-246	17	500	17	496
CAP69207.1|AA7	7.42e-246	17	500	17	496
CDP32688.1|AA7	7.42e-246	17	500	17	496
AEO62186.1|AA7	1.50e-244	10	500	8	490
ANF89368.1|AA7	8.01e-236	8	502	6	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	2.77e-237	8	502	6	496	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	2.15e-141	29	502	2	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6YJO_A	1.26e-136	18	501	23	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
1ZR6_A	1.13e-129	30	500	9	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6Y0R_AAA	1.28e-128	8	500	6	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	1.42e-236	8	502	6	496	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	5.64e-141	27	502	22	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	8.03e-131	11	500	8	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	6.59e-128	8	500	6	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	2.62e-114	29	501	28	492	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000551	0.999433	CS pos: 27-28. Pr: 0.5904

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07862-t26_1-p1.