CAZyme Information: SMAC_07737-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07737-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633		70248.55	7.0501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546177:70516-72483(+)

Full Sequence      

MWPFGSSYPTVAAADVDNQTFDYIVAHSRLRPSLRLSESPNVSVLLLERGQIRDNFLSRI
PLLSQNYNFPLLQSVVRHSEPIPSANNRRAAVWTAETLGGASRINAMLWTRGVAGGYNAW
SEEYGLDGWSWEKVEPAFRSIEGIVDIRKPGLELECIPFVEEAAKRVGLPVGDGVNAAEA
KAQGIMPLEQTLDGRGQRLSAYKAWLPREVARERRKRLIICPGVVASRLLFNKDGTRAIG
VRIQSGDHEHTVHARREVILCAGTIGTPQLLMLSGIGPPEQLESIGVPVIRNHPAVGQGL
SDHVNLPIIMELPRKHTIHCLENALVFLWHLLLYLFLGKGLLASGSTPRSIFVRTSALDE
DTLTVRTRDPSDQDTMDASLGRNIPDVEIIIIPISCLAVNVPGRAFFTWYTTLVQPHSKG
HIELASADPLADVKIFYPMMTDERDRATMKKAVRFSMRLAEEFGKTGYPYEAPLAFAPGM
DLGYLDSIYESKPGLWQRLWGKEKPADEEPVPVPGKDLLPGAGQPSPAFSTQITHQDSKK
LDWRTVTDQEIDAYVSRVCVSSLHVSCTCRMSNNPREGVVDQKLKVHGVENLRIADASVF
PKIPSAHTMAPVVMVAERCAEFVKAEWEERKDR

Enzyme Prediction     

No EC number prediction in SMAC_07737-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	625	1.4e-125	0.9647887323943662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.19e-82	18	620	3	528	choline dehydrogenase; Validated
225186	BetA	9.76e-72	35	626	25	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	7.64e-47	35	623	18	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.31e-39	83	303	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.49e-33	416	619	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92880.1|AA3_2	1.79e-189	1	630	1	618
VBB80495.1|AA3_2	6.23e-175	8	626	50	671
CDP28838.1|AA3_2	2.49e-174	36	626	81	671
UKZ47954.1|AA3	5.71e-163	35	631	1355	1918
QBZ58631.1|AA3_2	1.25e-147	2	633	3	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	2.00e-40	16	623	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	2.40e-40	12	623	75	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.42e-40	12	623	15	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	3.71e-40	16	623	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.71e-40	16	623	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2T6D0|BETA_BURTA	4.64e-54	21	624	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	4.51e-53	21	624	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B4EHJ2|BETA_BURCJ	4.51e-53	21	624	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=betA PE=3 SV=1
sp|Q3JLL7|BETA_BURP1	1.16e-52	21	624	6	533	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=betA PE=3 SV=1
sp|B7V5R3|BETA_PSEA8	1.50e-52	18	624	2	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998491	0.001537

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07737-t26_1-p1.