CAZyme Information: SMAC_07654-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07654-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		52215.71	6.0928

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546234:177615-179124(-)

Full Sequence      

MRIRTIQALLLAQFVTTAITTGTKDDTYDYIVVGAGVSGLVVANRLTGDKNVSVLVIERG
SFDDKPEAIVPYYANGLDLDVLISPTSAPNPQLNNDTFSVAVPAVVGGGSVVNGMGYLRG
SKEDYDAWEALGNPGWGWDDLLPYFRKSTTFTPPTPDAVNEFNITWDHTAYDNGPLHVHI
PSFQYPDINTIWDAFRSQDDIPVRADENAGNGPGAYWLPSTIDGCDMTRSTARKAYYDPV
NATRPNLHLLTGHTARQILFTESGPSLTANGVRIICRANNSTRQVYARKEVILAAGAIQT
PQLLQVSGIGPSSVLKAARIRVKKDLPAVGTNLQDHATTILIFSLTNQSFPNPDSLTTNT
TYFDAAWAEYLANLTGPISAAPASSAILFGLPHLNTSAAASATAVKLLSQSSSETLSYLP
PIYSTTPSLLRGFTLQRSLLAKSYLSPNSSIVAHSMPGNGFMPARFSSPSPAEPSRSTPL
TLSDYQ

Enzyme Prediction     

No EC number prediction in SMAC_07654-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	27	402	6.4e-116	0.6566901408450704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.38e-55	23	336	1	299	choline dehydrogenase; Validated
225186	BetA	1.01e-52	27	383	7	347	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.38e-29	29	336	2	291	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.06e-27	117	336	38	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.46e-08	20	342	48	334	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79447.1|AA3_2	1.82e-174	23	464	31	468
CDP27814.1|AA3_2	8.82e-168	23	464	31	460
QRC90410.1|AA3_2	1.20e-116	28	460	30	457
CAE7022803.1|AA3_2	4.21e-115	19	460	26	460
QDS73255.1|AA3_2	9.87e-113	20	451	14	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.20e-94	28	451	6	421	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.89e-63	26	449	34	470	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	1.12e-46	27	335	5	315	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	4.57e-42	8	379	16	382	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6XUT_A	5.65e-39	21	335	10	328	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	6.15e-80	8	362	18	367	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.16e-57	20	357	35	382	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.16e-57	20	357	35	382	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q988C9|4PADH_RHILO	8.16e-42	26	343	5	303	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	2.35e-41	8	379	16	382	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.524108	0.475901

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07654-t26_1-p1.