CAZyme Information: SMAC_07631-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07631-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		61228.71	4.8153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546234:64013-65695(-)

Full Sequence      

MKALTSILTPILGLIPVRQLSPEPQPQSQSQVQPPSSCPDYSSYAKTRHPPYSSGRHSLS
YQRPSPQCRTFNSSIIESFITNMSTVISDPDHYRLFQNTYPNTLDTAIKWHGVAANNSAE
ELTFIITGDINAMWLRDSANQLASYLPFLTPSSSRDSLASLYRGITNLQSRYLLTSPFCN
SFQPPSESGIPPASNSAASSDTVFPPYDASKVFECKYELDSLASFFQISAQYHAATNDTA
FFGKFQWLDAVQIVLDTAKKMMTPTYGPDGQVLDSPYTFTRMTTRTTETLANDGLGSPVA
RDTGLIRSAFRPSDDSTLFQFLVPSNMMFARYAGDVADIVEALSSLADAQPETGSGSGLK
APPPGLGEELAALSTSLRAAIEKHAIITLPSLSPSPNTTETDSKTEVIYAYEIDGYGSFN
LMDDANIPSLLSSPLFGFLSPSDPIYLTTRARILGNNTNPYMMHGPVINAVGGPHAGPGM
AWPMGSIVRILTSDDDEEIFGTLKELVGSTDGLGLIHESVNSWDGKRWTREWFSWANGLF
GQMIWDLGRRKPELLGRSYQ

Enzyme Prediction     

No EC number prediction in SMAC_07631-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	89	544	1.6e-153	0.9950248756218906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	89	545	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.14e-120	68	558	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA30843.1|GH125	3.30e-316	1	560	1	555
AEO64752.1|GH125	1.09e-234	38	560	25	528
QRC91719.1|GH125	1.28e-217	36	560	19	513
QBZ57723.1|GH125	5.28e-217	36	560	60	563
CBX94219.1|GH125	2.65e-213	36	560	63	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	9.63e-75	63	555	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.42e-74	63	555	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	4.42e-72	63	555	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	2.35e-57	71	546	3	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
3QT3_A	2.41e-57	75	546	11	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.12e-126	34	558	23	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000016

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07631-t26_1-p1.