CAZyme Information: SMAC_07410-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07410-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		53896.83	10.0001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546156:69571-71037(+)

Full Sequence      

MAASPADSTAVKSSLFNALFSRPLPLYLSAFLLRAILLLYSLWQDANSPVKYTDIDYLVF
TDAARFVSRGESPYARETYRYTPILAWLLLPTTWTAGAQWGPLAAKVINTAWFSSGKVLF
AAADLVAGWLIERVLVMGTDFPAQEEKKKETEGEEKGGKTGGGKSNDGTAMAPSRARAFA
AIWLLNPMVATISTRGSSEGLLGVLVMALLWAVLSRRITLAGLLLGLSVHFKIYPFIYAP
AIVWWMDAERLADDRIRSPSSSSSSSTSTSSLFRKMKNFLTLPRLNLAITSLATFLSLNF
LMYALYGQPFLQETYLHHVTRIDHRHNFSPYNTQLYLSSASTPLPTSSPSATAPLGQLKI
ESLAFLPQLLLSTILIPLALAKKDLPTSLLAQTFAFVTFNKVCTSQYFLWYMVFLPLYLP
RSSFLRSKRMGLSALGLWVLGQGLWLQQGFELEFLGRSTFLPGLWAASLGFFLVNCWILG
VIVGDGGR

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	192	483	1.6e-97	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	5.05e-84	26	483	11	415	GPI mannosyltransferase
252941	Mannosyl_trans	3.59e-74	192	483	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81264.1|GT50	1.01e-207	5	485	13	441
CAP65259.1|GT50	2.03e-207	5	485	13	441
CAD60578.1|GT50	2.03e-207	5	485	13	441
CDP29471.1|GT50	2.03e-207	5	485	13	441
QBZ54528.1|GT50	1.05e-184	5	485	7	426

PDB Hits     

SMAC_07410-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	3.80e-261	13	488	16	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	4.77e-170	18	485	3	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4I073|GPI14_GIBZE	6.09e-170	20	488	7	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	4.77e-167	17	487	2	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.68e-165	17	487	2	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000012

TMHMM  Annotations     

Start	End
24	43
84	103
192	214
221	243
285	307
362	381
396	418
431	446
461	483