CAZyme Information: SMAC_07148-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_07148-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		29724.38	4.4078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546195:22574-23362(-)

Full Sequence      

MSKRGLTFPVSSPDPPFLFSKPGSLVSWLYNWSPRLTPGTGPGCSLHFVPMQWNHVYIDE
LPGHLNACYPDPDPECNGQPTILGFNEPELPDQSNMDVALAAAEWLRVIEPLRRQGVRAG
SPGISSAPQGVTWLREFMEAIRSQGSDVDFYCLHWYGGANLGGFLWYYIWSTHHQLGPDK
PVWITEFACTNWNQEDPIPKEEVENFCRESCKYLDTLDWVERYAWFGAMRPETIGNVGRW
AAFLGDEGELTELGAWYRDCAE

Enzyme Prediction     

No EC number prediction in SMAC_07148-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	22	257	2.3e-61	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.64e-60	12	257	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13038.1|GH128	1.75e-108	2	259	28	269
QIX01917.1|GH128	1.82e-105	2	259	3	247
SMQ49852.1|GH128	1.78e-102	2	259	43	285
SMY23538.1|GH128	1.84e-102	2	259	44	286
SMR50837.1|GH128	2.05e-101	2	259	43	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	4.78e-24	28	233	47	242	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.29e-23	28	233	47	242	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	3.48e-23	28	233	47	242	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	3.48e-23	28	233	47	242	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
6UB7_A	3.66e-20	3	257	31	281	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.06e-25	26	257	318	528	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000026

TMHMM  Annotations     

There is no transmembrane helices in SMAC_07148-t26_1-p1.