CAZyme Information: SMAC_06995-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06995-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		35548.82	9.1103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546218:196551-197927(-)

Full Sequence      

MKSLLSFLPLILSLFPPAALAATRTSPPSTTCLTVGPSSSQKFSTIQSAINALSTTSSSP
QCIFIYPGTYREQVLIPSRAAQLSIYGSTTSTLSYASNAVTILSSKSQADGLTNDETATL
RVKSKNARLYNLNVENGYGKGSQAVALSVYAEGVGVYGCQLKGFQDTVLAQEGAQVYARS
LIQGATDFIFGQRAPAWFEKCDIRVVAASIGYITASGRDSSTNPNNYVFNACTIAAADGH
SISSGAYYLGRPWREYARVTFQKTSMTNVINAAGWKIWNTGDERTSNVAFTEYANTGAGA
SGTRAGFSSKLGAAVKIESVLGSGYAGQGYYDGSYM

Enzyme Prediction     

No EC number prediction in SMAC_06995-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	34	309	1.4e-77	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	4.17e-46	33	314	13	275	putative pectinesterase
178372	PLN02773	5.87e-45	28	300	2	270	pectinesterase
395871	Pectinesterase	1.17e-43	34	301	3	267	Pectinesterase.
178113	PLN02497	4.34e-42	33	314	34	309	probable pectinesterase
215357	PLN02665	5.73e-38	17	311	57	340	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC59472.1|CE8	1.01e-137	15	336	9	326
UPK95258.1|CE8	1.12e-137	15	336	9	309
CEF78207.1|CE8	2.88e-137	15	336	9	326
CZS81503.1|CE8	2.88e-137	15	336	9	326
QKD62636.1|CE8	4.54e-137	15	336	9	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.46e-65	24	322	3	288	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.46e-65	24	322	3	288	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.74e-28	34	300	4	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.19e-27	43	300	15	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	8.63e-93	14	336	10	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.47e-92	13	336	9	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	1.33e-67	32	325	35	316	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	7.48e-67	32	325	35	316	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	7.48e-67	32	325	35	316	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999762	CS pos: 21-22. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in SMAC_06995-t26_1-p1.