CAZyme Information: SMAC_06985-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06985-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570		60151.39	9.8030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546218:154736-157156(+)

Full Sequence      

MTTTTPSPSASVRRSSAALTHPHRTILKSFLYWKLFLLAIAIGSTLVNDRAYDTSADLLL
IGDDEPLSVVDGNGAAELVRNFGKRLVTRFTSWDAIYFVSAAKRDYVFEQEWAFGTGLVV
AVRGVLRALQTLAPPLPLTTSPTALAEATTALLISNGSHLLASLVLYHLTLLLPLPGSNS
SPFQTKKLALLTSLLHIISPAGLFLSAPYAEAGLSFGLATLFRSNGILNGLPFAWEVFTL
LTGLAVSGGSTPPLKTLRRLIALGLGGIFVAMGSIVPQTVAWLRYCPSGSLWLLNKFLSL
SPGTTSSASGVGVSGTSGVSGSGSARGYGGSGSARGYGGSGVGAGVSVGADTGGLEGLVA
QEEAREWCTAVVPSIYTFVQKHYWNVGFLRYWTLPNIPLFLLAAPMLAILVKSALDQLSQ
RSPSSATAVVTLNSDRKDSTSPPACGSGLTSSLDPSSGPVKSEAIVTHQDPEPKTTAHDQ
RMQILIRSAAAEQILLAVLALSTYHVQIITRISSGYPLWYWWLAQQLIGGAGGDKQDKQK
NKKLGKGIVVFMVMYAAVQGVLFTSFLPPA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	27	570	6.1e-115	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.53e-20	31	570	6	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.24e-06	367	432	269	334	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA29338.1|GT76	3.50e-247	1	570	1	593
AEO64180.1|GT76	4.76e-116	18	570	9	455
CDP28476.1|GT76	1.08e-113	22	570	39	463
CAP66741.1|GT76	1.08e-113	22	570	39	463
AEO58925.1|GT76	1.31e-113	21	570	19	458

PDB Hits     

SMAC_06985-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	1.38e-113	20	570	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	6.27e-83	22	570	10	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	6.84e-55	21	570	17	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.86e-52	22	570	29	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.15e-30	25	413	6	279	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000029

TMHMM  Annotations     

Start	End
30	47
188	210
225	247
260	282
389	411
547	569