CAZyme Information: SMAC_06907-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06907-t26_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		42784.11	7.7067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546142:133812-135121(+)

Full Sequence      

MRALTLLAALSAAGASVTASPLGSPKPPKPAGSDINPFVGKKLFANPKWATKLEDTYRSF
TQKGDRANAAVVRKVQKTGSFVWVTSRSGLSEIDDAIRSARNEQRRTGQKQVVGLVLYNL
PDRDCSAGESAGELSSKNDGLRIYKEQFIKPYAAKLAAARDLQFAVVLEPDSLGNAVTNM
GVEFCKEAVPTYREGIAFAIKSLQLDNVALYIDAAHGGWLGWADNLPLAAKEFATVVSLA
NANNAPGSKNATIRGFSTNVSNYNPYLTSNTTRPRDPYTEWSPSYDESHYASSLSPYLSE
LGLPAHFIIDQGRVALPGAREEWGEWCNVEPAGFGHAPTADQKVLQNENVDAIVWVKPGG
ESDGECGLAGAPKAGAWFGGYVEMLVKNADASVKNRRV

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	57	367	6.5e-79	0.95578231292517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.29e-147	65	372	1	293	Glycosyl hydrolases family 6.
227616	CelA1	5.13e-38	36	390	24	411	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD71092.1|GH6	4.90e-222	1	395	1	382
AKI05479.1|GH6	1.45e-176	1	393	1	378
AGV05123.1|GH6	1.56e-175	1	393	1	376
AGV05122.1|GH6	1.42e-173	1	393	1	375
AEO57190.1|GH6	1.77e-172	1	396	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	1.83e-123	36	393	4	346	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	1.38e-108	35	390	13	376	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	2.22e-107	35	390	13	376	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	3.24e-81	30	390	2	359	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	5.11e-80	30	390	2	359	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	6.65e-165	1	393	30	411	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	2.73e-134	1	394	1	365	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	9.42e-123	36	393	4	346	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P49075|GUX3_AGABI	1.57e-82	36	393	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	4.78e-74	36	390	118	473	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000492	0.999482	CS pos: 19-20. Pr: 0.9671

TMHMM  Annotations     

There is no transmembrane helices in SMAC_06907-t26_1-p1.