CAZyme Information: SMAC_06860-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06860-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	NW_003546215|CGC1	70985.35	7.3349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546215:261371-264017(+)

Full Sequence      

MSPLPEEFDIIVCGGGSCGCVVAGRLANLDHNLKVLLIEAGESNLNNPWVFRPGIFPRNM
KLDSKTATFYESKPSKWLGGRGAIVPAAHILGGGSSINFMMYTRASASDYDDFQAKGWTT
KELLPLMKKHETYQRASHNRDIHGFEGPIKVSFGNYAYPIKDDFLRAAASQGIPVVDDLQ
DLKTAHGAEQWLKWINRDTGRRSDSAHAYIHATRAVHSNLYLACNTKVDKVIIENGRAVG
VQTSNEAYGRRNAEKLRKAGVKPIVDLPGVGLNFQDHYLTFSVYRAKPGTETFDDFARGD
PEVQKRVFDEWNIKGTGPLATNGIEAGVKIRPTEKELREFERWPTPHFKSGWETYFKNKP
DKPVMHYSIISGWFGDHMLMPPGNFFTMFHFLEYPFSRGSTHIRSADPYEVPDFDAGFMN
DERDMVPMVWGYIKSRETARRMDAYAGEVQNMHPVFDFDSPSRAYDLDLEDTNKYALPGN
ITAGIQHGSWTVPVPAADEKPNPLHVTSNRKAKRKELKYSDKDIKAVEDWVKRHVETTWH
CLGTCSMAPREGNSIVKHGVLDERLNVHGVKGLKVADLSICPDNVGCNTYSTALLIGEKA
AVLVAEDLGYSGEALQMKVPDYHAPGENRLTSRL

Enzyme Prediction     

EC	1.1.3.13:12	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	252	609	2.2e-125	0.5220338983050847
AA3	6	245	4.5e-106	0.4067796610169492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.80e-63	6	601	4	528	choline dehydrogenase; Validated
225186	BetA	1.49e-58	1	607	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	7.02e-29	79	278	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.26e-26	395	600	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.24e-08	6	121	54	158	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64928.1|AA3_3	0.0	1	634	1	667
AEO61126.1|AA3_3	0.0	1	634	1	659
CDP24596.1|AA3_3	0.0	1	634	1	669
VBB73833.1|AA3_3	0.0	1	634	1	669
UQC76782.1|AA3_3	0.0	4	634	5	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	4	622	3	650	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	1.61e-220	5	625	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	2.62e-219	5	625	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	7.94e-38	7	607	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.67e-37	7	607	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2QY27|ALOX1_KOMPC	0.0	4	622	3	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	0.0	4	622	3	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2R038|ALOX2_KOMPC	1.23e-317	4	622	3	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|C4R702|ALOX2_KOMPG	1.23e-317	4	622	3	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|Q00922|ALOX_CANBO	9.88e-310	4	622	3	650	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMAC_06860-t26_1-p1.