CAZyme Information: SMAC_06753-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06753-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		35368.65	10.1227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546152:112649-113803(-)

Full Sequence      

MHFAYPPRKSSNPPPFRPRTSAIPTIRSRRLKTIGLVCLAFLTLVWLFQRGGSRRHAPPA
YHKPSGNPPVVIVTVFNEGKYGKGYLDMVKENRLKYAEKHVLRLRPPRRTRLVGQPPRRP
TRHDHVPDAAYIWYLDQNAFIMNPNLKIEEHVMKPSRLEELMIKDHPVVPPDSIIKTFSH
LKGHDVDFVLTQDKDGLSSSSFVVKNGEWAKFFIETWFDPIYRSYNFQKAEQHALEHIVQ
WHPTILAKLALVPQRILNSYSKEKGGQDYKEGDLVVRLYACGEAGEDTCETESQRFAQWK
TAFQNS

Enzyme Prediction     

No EC number prediction in SMAC_06753-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	126	286	3.4e-59	0.6910569105691057

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.72e-84	66	287	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF58113.1|GT34	1.41e-192	1	306	1	324
CAB91762.2|GT34	1.41e-192	1	306	1	324
VBB77835.1|GT34	1.42e-131	1	306	1	313
AEO71720.1|GT34	3.15e-126	1	306	1	315
CDP27323.1|GT34	2.86e-125	1	306	1	308

PDB Hits     

SMAC_06753-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	6.94e-34	28	290	8	300	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|Q09174|GMA12_SCHPO	3.04e-26	127	306	175	356	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|O94622|YBKD_SCHPO	5.80e-26	127	281	175	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q10359|GMH3_SCHPO	1.10e-24	127	281	154	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P46985|MNN11_YEAST	1.30e-24	56	292	146	411	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000015

TMHMM  Annotations     

Start	End
31	48