CAZyme Information: SMAC_06610-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_06610-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		40739.49	8.5422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546178:140613-141753(+)

Full Sequence      

MRLPFATAAALLPILTPLAAAQLHHYATLAGLKYFGAATDTPGQRERAGYEASYAHSGKP
HPRTGKNGSSPKPSPGVFNFTEGDIVVSLAAKTGKLLRCHALVWHSQLAPWVEAKNETEW
TKEELSAVIVRHIEGVMGHYRGKCYAWDVVNEALNDEDGGYRQSVFYKVLGEEFIRLAFK
TAAEVDPSAKLYYNDYGIERPTSVKTEGTRKLVKMLRDAGLRVDGVGMQAHMHADNHPTA
GDLEATMRGYVQAGAAEVAFTELDVRITIPVNETSLEWQKDGYQKVARACVKVKECVGIT
LWDFYDPFSWIPYTFPGKGAGLLWFEGFGKHPAYEGIIDTFKELIKEGAGKCGRRLSRMR
RATLPKGSA

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	67	339	3e-78	0.8481848184818482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.47e-104	33	339	10	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.79e-95	73	337	8	263	Glycosyl hydrolase family 10.
226217	XynA	2.48e-64	1	339	7	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH08898.1|GH10	7.29e-161	1	355	1	361
AEO63459.1|GH10	6.93e-158	19	358	18	362
CDP26069.1|GH10	2.66e-154	17	350	15	354
CAP73667.1|GH10	2.66e-154	17	350	15	354
VBB76151.1|GH10	5.36e-154	17	350	15	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.36e-95	21	338	1	314	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	6.76e-87	6	338	10	336	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	2.21e-85	19	340	1	323	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	2.98e-70	33	337	14	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
1V6Y_A	8.22e-70	72	341	53	314	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	2.54e-86	19	338	17	331	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	1.13e-84	19	340	1	323	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|P79046|XYN1_HUMGT	3.38e-83	19	340	17	336	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|I1RQU5|XYN1_GIBZE	5.89e-83	30	346	28	345	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|O60206|XLNA_AGABI	1.57e-80	22	343	18	333	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001785	0.998199	CS pos: 21-22. Pr: 0.9552

TMHMM  Annotations     

There is no transmembrane helices in SMAC_06610-t26_1-p1.