CAZyme Information: SMAC_05858-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05858-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		66390.61	5.2431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546171:89897-91711(-)

Full Sequence      

MDDVLSIRSRSSSPSSVTSKTLEVCLVHEEVEVEIEADDHEEHQERLGPLILITHRRSRS
PLSSPPVTPPLQAKCDVLRDYLSYADEDSASDSDSNSDYYNGFLESPTSTPRSRLCHRYR
STAGNSSDGLLPAYPYHLYDLSPSRSHPSQHCYSAPEASNMFSLLINNPRTFIRFIFGIA
FFMCFLTNMVSGGPLAQHLRDAFHGHRPWPHDPHHEGDLRRRDNAQSQTPPPQGVIRVAA
APVQIDPEGVYIRASPFFNSSTGQPDTSRIIAGYAAVDGTDRVLRTSVSIDSGASWSFLG
EVTRLPNDGTSDLDNAMPLALPSGRILFAFRHHSLVPSISSPTSFRYTQYRLSVCSSSDG
GKSWTFLSHIDERPACGDPAQLNGLWEPFLRLGADGKTIQAYYSSENSASDQNNLMRFST
DEGKTWSDPPILVSSSSSSDSRDGMTGVSAVSSSPCRQKELICVFETTLPDGTFSIARVL
SYDDGRTWGERETVYMAKDRKWAGAPQVYLVGETLVTSFLTNEGTDMPKIDGAYTKMVVS
KDQGRTWTGTRGMEQAETVAGVGSHWPGLFSLNETHFLALYSTDAMGAVGHLLSVAGAEE
EEER

Enzyme Prediction     

No EC number prediction in SMAC_05858-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	266	526	8.8e-59	0.8306188925081434

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	3.00e-10	280	490	45	239	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.04e-09	269	432	157	299	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.01e-07	202	499	30	304	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.09e-06	407	548	36	187	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.18e-06	357	548	52	238	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS95310.1|GH93	1.18e-88	234	589	29	355
UKZ63990.1|GH93	8.87e-88	234	589	29	354
UKZ70572.1|GH93	1.50e-86	234	589	31	357
UKZ88867.1|GH93	5.53e-86	234	589	29	355
UQC86738.1|GH93	3.05e-81	232	592	30	358

PDB Hits     

SMAC_05858-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SMAC_05858-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000001

TMHMM  Annotations     

Start	End
171	193