CAZyme Information: SMAC_05626-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05626-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	NW_003546212|CGC1	70652.48	6.7379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546212:69505-71469(+)

Full Sequence      

MILRRLLGLAFAAVPLASAVELTGYEYIVVGSGAGGGPLAARLAMAGHKTLLIEAGDDQG
NNINVTVPAYNARSSEDEKMSWDFYVRHYPDDKQQARDWKTSYRLPDGSIYTGLFPPEGA
EMLGTLYPRAGVLGGCTAHNALIAVYPHQSDFQYLADLTGDQGWSPSNMRKHFVSMEDKN
YVNGLYSGHGRDGWLSTEVTPLTIPLKDPQLLSLTLGGAFALGNITQSPINLATVLAGDL
NANTIARDKKPAYYETPLSSKNGARSGSRDFVVAVRDARKPDGSKKYPLDVRLNCHVTRI
TFNTSSSSSEPIATGVEFLDGAHLYRASPLSANRANNVRPNGTPGSAHASREVIISGGAY
NSPQILKLSGIGPRTELEKFGIPVLVDLPGVGGNLQDHYEIGVNVKVPKDWTALKGCTFQ
LYGNTSDPCLDRWLNPVLGDRGTYASSGLAVAMLYKSSVTTDDSYDVFTFGGPVNFAGYY
PGYSVDITAEHDWWTWAILKAHPRNRAGTVSLRSSNPLDTPVINYNYFDFGSGDYQADLT
AMREAIGLARDALKRQVVRTQEVRPGADIQSDGEIEQFIKDGAWGHHASSTCPIGADGDP
MAVLDSKFRVRGVKGLRVVDASVYPRIPGTFTAVSTYLAAEKAAVDILEGLKKN

Enzyme Prediction     

No EC number prediction in SMAC_05626-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	649	2.1e-93	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.84e-63	25	648	6	532	choline dehydrogenase; Validated
225186	BetA	1.26e-61	25	649	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.13e-32	503	643	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.97e-18	25	630	56	559	Protein HOTHEAD
366272	GMC_oxred_N	4.23e-11	125	400	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76690.1|AA3	0.0	1	648	1	641
CDP26593.1|AA3	0.0	1	648	1	641
QMW33146.1|AA3	0.0	1	651	1	645
QRD84722.1|AA3	0.0	1	651	1	645
QMW45179.1|AA3	0.0	1	651	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.16e-39	25	644	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.13e-39	25	644	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.89e-39	25	644	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.89e-39	25	644	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.46e-39	25	644	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	1.04e-47	25	648	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.78e-46	25	648	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	2.38e-42	23	648	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|B9JBA2|BETA_AGRRK	2.18e-41	26	648	4	526	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	2.18e-41	26	648	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000851	0.999119	CS pos: 19-20. Pr: 0.9674

TMHMM  Annotations     

There is no transmembrane helices in SMAC_05626-t26_1-p1.