CAZyme Information: SMAC_05301-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05301-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	NW_003546183|CGC1	29678.25	9.5282

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546183:98830-99817(-)

Full Sequence      

MKSIHHPLPLLLQTLTILFLLPSSSLASSKTLLLPSTSFNPSSTFNTYWSLNYPWGTDHN
GAARMSPSQVSTSSSSDGGTSSTLTLTARRVTGQKPATHGGKQIPIKYLSGAIHAKQHFT
ITSPSSPSSSSSVSGYDFSAEFRAPVAKGTWPAFWLTAVNGWPPEIDMAEWKGSGKISFN
TFNTSSQVMARDVAYRSENGNDWHKVLCEVRRDGRNGGKDVEVRFWMDGKLVVTQWGRGI
INLQMEGSSGSPGPEVDTLYQVRNLEVWGYGD

Enzyme Prediction     

EC	3.2.1.181:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	47	253	6.9e-74	0.9897959183673469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	1.55e-08	84	258	47	220	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185690	GH16_fungal_Lam16A_glucanase	0.001	145	170	91	117	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185683	Glyco_hydrolase_16	0.002	138	245	70	177	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KHE89680.1|GH16_10|3.2.1.181	2.71e-143	2	272	33	300
QBZ59743.1|GH16_10	4.26e-82	53	270	49	256
UQC81933.1|GH16_10	2.71e-81	53	270	88	292
AEO69030.1|GH16_10	2.81e-79	26	245	22	220
AEO58155.1|GH16_10	4.31e-75	12	241	4	212

PDB Hits     

SMAC_05301-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F7J1C8|E3GAL_FLAVE	1.33e-57	53	272	41	249	Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes OX=38945 GN=EN3GAL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999763	CS pos: 27-28. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in SMAC_05301-t26_1-p1.