CAZyme Information: SMAC_05265-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05265-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041	NW_003546190|CGC4	103758.85	4.0212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546190:403277-406512(+)

Full Sequence      

MHKSIVAAAVLAATAQAATAVSEPKVNVYWGQKGATRLRDHCDQANFDYVTIGFVNNSPE
QDKSGLNYPGTNFGNHCDAIYYTNSKTSLASPLLSKCTVMAADIQYCQEKGKKVLLSIGG
ASVTGSNYALSSNTKGEEFATFLWKSFGPYDSKYTGPRPFDYAGNHVSVDGFDLDIEVKF
SSAGQAAYVALAKKLRQYYNNDSRYLLTAAPECPLDTANFKMKDIIAGAQFDALFIQYYN
NPGCAAASATGGLNTGFNYLAWEAAIASGKSKNAKLFIGLPGSSEAAGSGYLEPVKAASL
ISSYKTRASFGGAMIWDVYYGQKATNGKTFVDAINTACKGAKASPTTTAAPAPTAIGCTA
YHTVAPGEFCYLIAQNNGLSVSDLLRFNPKLDSACALEVGQVLCIKQGVITITSSSSSSA
VITSSSTSSSSSVSSSSVESTTSTSSVAPSSTEAVSSTTSESETVTSSATVSESASVIIS
ESASSTITSAPVVISSSAISSEVPSSTEDDTCEDETTTSSEIVSSTEAPVISATESASVT
ESATESAIVSETASATESASVTESASITESSLISISFSTEVPTTTDDACEDETTTSEVPS
ATEGPSDGSSTTVDPSIITSAPVVIPSGSGSSEIISSTTTEDDTCEDETTTEAPVGSATE
SAIVSSTEAPVVSATESAVPSDIVSESILPSGILPSGIIPSGVIPSGVIPSGIVSESIIP
SGVVPSGVIPSGVIPSGVVPSGIVSSIISEITAGPTDGSPISSAPGAGVTSAPAEEWTTS
TIYTTTTSANAPTGIITSSIPIESIPAGFTTSTIYTTTTSTITSCAPTVTNCPGKIGQVT
TIVVPIGVTVCPITEAFPPATSVPAAPSAGVPGAPGAPAISAPAVPSGGAGVSVPSGGAP
GVPEVDTTSTTSVTSVHFTTVTVAKPTASAPGAPGAPGAPGAGVPAQSSVVAFPSEVPSG
GNPVPPVVNAPAVPSGTAPAGTGVSAAPSSVPSTYSMPAPPAQTEPVTGSEPSEVPVTAG
AGRNVVAFGVPALMAALVLAL

Enzyme Prediction     

No EC number prediction in SMAC_05265-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	25	286	1.1e-25	0.6655405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	7.91e-102	24	334	1	278	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.04e-19	25	344	1	294	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	5.05e-16	102	333	64	308	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
212030	LysM	4.93e-10	361	405	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	2.30e-09	361	405	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65134.1|CBM50|GH18	9.38e-107	1	417	1	415
AEO54851.1|CBM50|GH18	1.69e-105	10	415	7	413
CDP24384.1|CBM50|GH18	5.84e-94	3	418	4	424
VBB73572.1|CBM50|GH18	5.84e-94	3	418	4	424
CDN29912.1|CBM50|GH18	5.84e-94	3	418	4	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	2.05e-56	28	317	5	285	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	2.11e-56	28	317	6	286	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
4TX6_A	2.11e-56	28	317	6	286	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2UY2_A	4.14e-42	26	332	8	281	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
3MU7_A	3.66e-33	26	320	5	258	Crystal structure of the xylanase and alpha-amylase inhibitor protein (XAIP-II) from scadoxus multiflorus at 1.2 A resolution [Scadoxus multiflorus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WEP7|CHIA1_ASPFU	2.08e-53	7	317	12	313	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|Q873Y0|CHIA1_ASPFM	3.84e-53	7	317	12	313	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|D4AT07|CHI1_ARTBC	2.28e-52	11	317	17	326	Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07371 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	1.13e-51	20	334	24	332	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|P54197|CHI2_COCP7	7.21e-48	28	317	33	315	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999725	CS pos: 17-18. Pr: 0.9835

TMHMM  Annotations     

There is no transmembrane helices in SMAC_05265-t26_1-p1.