CAZyme Information: SMAC_05159-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05159-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	NW_003546186|CGC1	45974.29	7.3714

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546186:486467-488649(+)

Full Sequence      

MRPILVRSAFRVAIIAIPILFALHYFITHLLAFIHIFYQHPGIAITQRQVANAYLNGTTL
LRGERETGTRKDSKEYIPKIIHQIFHNWKDPENKTLPSDWDAQRRSCVDNNPGWEYRLWT
PSTSLAFLTTYYPTFLPSYLSYPHPVQRVDALRYFLLFHYGGIYLDLDNGCLPSISPTAN
SLDPLISYPLWITDGGRGALSNNILAARPGHPFWGRVVAELIEGRGAVPQGRGETVTGFW
KRWWCAWGVLRYVEVSWGVGQWFLGGVWDEYHALLEMGRDMRGEMDGVVDEEKSGRLYRL
MMDDRPGMDEWVFFTQGRGGTWNGWDNRLFLEIGDHLGASSYIPALPYRSSHMHAGIAQR
SRYYSDSGSLGGGTWNILYGMRTRHGGFIFPQQEFLVDDAIA

Enzyme Prediction     

No EC number prediction in SMAC_05159-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	100	180	2.6e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.43e-30	2	214	1	207	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.42e-16	97	178	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB75740.1|GT32	2.18e-98	7	337	2	293
CDP25656.1|GT32	4.36e-98	7	337	2	293
CAP73255.1|GT32	4.36e-98	7	337	2	293
AEO56548.1|GT32	7.25e-98	16	337	13	300
AEO62991.1|GT32	1.15e-89	16	336	18	303

PDB Hits     

SMAC_05159-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	7.12e-34	77	221	57	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.09e-32	77	337	82	296	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	1.40e-32	75	337	60	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.55e-32	75	337	53	266	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.56e-25	75	221	62	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999856	0.000187

TMHMM  Annotations     

Start	End
12	34