CAZyme Information: SMAC_05052-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_05052-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		50593.34	6.6106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546186:32518-34016(+)

Full Sequence      

MVAKLLLAAALTASALAAPVLEDRQNCGSSWSQCGGIGWSGATCCSSGNYCSEINPYYFQ
CLPGAATTTKASSTSPTSTSKVSSTTSKVTTSSANQPITTTAPSVPTTTIAGGASSTASF
TGNPFVGVQGWANSYYSSEIYNHAIPSMTGTWAAKASAVAKVPTFQWLDRNITVDTLMKS
TLQEIRAANKAGANPPYAAHFVVYDLPDRDCAAAASNGEFSLANNGINNYKTYINAIRKL
LVEYSDIRTILVVEPDSLANLVTNTNVAKCANAASAYKECTNYAITQLDLPHVAQYLDAG
HGGWLGWPANIGPAATLFADVYKNAGKPKSVRGLVTNVSNYNGWSLASAPSYTTPNPNYD
EKRFVEAFSPLLNAAGFPAQFIVDTGRSGMQPTGQIEQGDWCNAIGTGFGTRPTTNTGSS
ITDAFVWVKPGGESDGTSNTSAARYDFHCGLSDALKPAPEAGQWFQAYFEQLLKNANPAF

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	149	441	8.4e-92	0.9319727891156463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	5.90e-155	163	444	15	293	Glycosyl hydrolases family 6.
227616	CelA1	1.01e-43	123	479	24	442	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
197593	fCBD	1.80e-12	30	62	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	6.28e-11	31	58	2	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70733.1|CBM1|GH6	7.85e-295	4	480	5	484
AGV05128.1|CBM1|GH6	1.49e-238	5	480	5	482
ABT06036.1|CBM1|GH6|3.2.1.91	8.26e-238	1	480	1	481
AEO62210.1|CBM1|GH6	8.26e-238	1	480	1	481
VBB75002.1|CBM1|GH6	7.14e-235	1	480	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A05_A	6.49e-207	117	480	1	364	Chain A, Cellobiohydrolase Family 6 [Thermochaetoides thermophila]
1OCB_A	6.89e-199	120	480	1	362	Structure of the wild-type cellobiohydrolase Cel6A from Humicolas insolens in complex with a fluorescent substrate [Humicola insolens],1OCB_B Structure of the wild-type cellobiohydrolase Cel6A from Humicolas insolens in complex with a fluorescent substrate [Humicola insolens],2BVW_A CELLOBIOHYDROLASE II (CEL6A) FROM HUMICOLA INSOLENS IN COMPLEX WITH GLUCOSE AND CELLOTETRAOSE [Humicola insolens],2BVW_B CELLOBIOHYDROLASE II (CEL6A) FROM HUMICOLA INSOLENS IN COMPLEX WITH GLUCOSE AND CELLOTETRAOSE [Humicola insolens]
1OC5_A	1.49e-198	118	480	1	364	D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with methyl-cellobiosyl-4-deoxy-4-thio-beta-D-cellobioside [Humicola insolens],1OC6_A structure native of the D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS at 1.5 angstrom resolution [Humicola insolens],1OC7_A D405N mutant of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with methyl-tetrathio-alpha-d-cellopentoside at 1.1 angstrom resolution [Humicola insolens]
1BVW_A	1.83e-198	122	480	1	360	Cellobiohydrolase Ii (Cel6a) From Humicola Insolens [Humicola insolens]
1GZ1_A	1.13e-197	120	480	1	362	Mutant D416A of the CELLOBIOHYDROLASE CEL6A FROM HUMICOLA INSOLENS in complex with methyl-cellobiosyl-4-deoxy-4-thio-beta-D-cellobioside [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ABX7|CEL6A_PODAN	5.14e-235	1	480	1	484	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6A PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	4.00e-230	3	480	2	476	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|P46236|GUNB_FUSOX	1.62e-192	6	480	5	461	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q0CFP1|CBHC_ASPTN	4.03e-192	13	480	8	468	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1
sp|Q4WFK4|CBHC_ASPFU	2.84e-191	19	480	15	454	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999724	CS pos: 24-25. Pr: 0.9039

TMHMM  Annotations     

There is no transmembrane helices in SMAC_05052-t26_1-p1.