CAZyme Information: SMAC_04725-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_04725-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224		24016.99	8.1232

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546184:254421-255182(-)

Full Sequence      

MVATIQLLSGLVGSLAFLSQASAGPLVTEQVRIMALGDSITGNPGCWRALLSRKLSATNI
DLPLPYSQIRFVGTQQRTYCGYGSAYDWPHEGHGGFLATGIASTTVPILSILSDLPLLTQ
PLLTSWLLNPDVSLLGRPVDIVLMHLGTNDIWQGRPTAEILGAYGALLNQMRAVNLRVRL
LVAKILPMQPANCPSCAAKVQELNTYIPLWAAYVNGQNVLGQVG

Enzyme Prediction     

No EC number prediction in SMAC_04725-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	31	215	9.1e-33	0.7680412371134021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.81e-22	31	212	1	111	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.35e-09	35	215	1	141	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	1.56e-07	128	217	41	138	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238868	XynE_like	0.003	131	207	68	151	SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238879	NnaC_like	0.006	140	207	53	122	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKV71809.1|CE3	8.72e-47	19	212	40	202
AKG46491.1|CE3	2.20e-46	19	212	33	198
AUS81639.1|CE3	3.23e-46	8	212	20	191
BCY07749.1|CBM2|CE3	7.74e-46	21	212	147	304
QQN76321.1|CE3	1.75e-45	23	212	41	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	4.17e-17	30	210	1	149	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	1.13e-16	30	210	1	149	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

SMAC_04725-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999599	CS pos: 23-24. Pr: 0.9701

TMHMM  Annotations     

There is no transmembrane helices in SMAC_04725-t26_1-p1.