CAZyme Information: SMAC_04422-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_04422-t26_1-p1
• CAZy Family: GH144
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
910	NW_003546100|CGC1	101466.61	6.1565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546100:231596-234705(+)

Full Sequence      

MAGSHSGGKDFPLRPLPPSRNPSSTPSDLPSPLNSPLRSNFHHGPISGVDTPPSSELQGP
GSFYTQNGTGSALSVASDQTGMSTPVTYADEFRFKTMIKYLSKQIEKAGWVPPEKERKPP
NGYGVLYKKSRGQYVTYPEDLSQAVTSCVQRLNLVIAFTMKPEMLDGILASLSPNQSELK
LMDGSQLQIADSLNSMVPANVKKFQYACLVRQEGILLVWHDDLQHIVPTAARIEEKMLAM
VWGTGQLPFGRLQAPSRPNSVLSTNTSIYKAEKPSTPGPSNMGALPNDSAEQLEKDESVD
TKESLQRPVQRTSAFFVGMAMCLGIVLLFGTYISQLLIECVVDGTYTRLALIVCVPFLLC
VSLFFFQVIFSNLFQIVGPIGGQHSNSRFYSCIKPSLRRAYMDGFTAPHITIQMPVYKEG
MESVIIPTVRSLQAAISFYESHGGSASIFINDDGMRVISEEEAQKRIEFYHDNHIGWVAR
PKHGDDGFIRKGKFKKASNMNFALNISQKVEKYLQEMVDAKLAAEGTDLIDEQEEEEMYQ
AALARVLEENPLAQAAGNIRMGEYILIVDSDTRVPVDCLLYGAAEMFLSPEVAIVQHSTG
VMQVSWDYFENGITFFTNLVYTAIRFSIGSGEVAPFVGHNAFLRWQAVQDVGVPEANEYM
AYWSESHVSEDFDIALRLQIKGSIVRIASYHGTQFQEGVSLTIYDEIARWQKYAYGISIF
AYICSYFALASALMLTLLNYFLVGWFVDTLDHAYMSSWQVFVSLVVVFNIMGHIALAALR
YRTGERSLLSSLCENFKWTPMLTVFFGGLSFHVTTALLAHLFHLDMQWGATSKEKENSNF
FQEIPKILKTFKWMYVFLIIVAAGMVYLGKFAPKGWEIQDFTAIVPLAINLVSHALTPLV
LNPSLMVFNY

Enzyme Prediction     

No EC number prediction in SMAC_04422-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	564	763	2.5e-51	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.07e-50	564	767	1	188	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.37e-12	412	671	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	4.52e-06	562	868	138	414	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
224137	GT2	5.09e-06	563	743	86	274	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
184755	hmsR	7.36e-04	515	681	91	266	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC28725.2|GT0	0.0	39	910	91	1003
EAA31489.2|GT0	0.0	196	910	1	752
UNI18966.1|GT0	0.0	88	910	46	905
QLI74022.1|GT0	0.0	71	910	22	902
QUC19563.1|GT0	0.0	88	910	49	911

PDB Hits     

SMAC_04422-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SMAC_04422-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

Start	End
314	336
349	371
725	747
760	782
802	824
851	868
883	905