CAZyme Information: SMAC_04376-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_04376-t26_1-p1
• CAZy Family: GH135
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
954		107326.47	6.1044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546100:30108-33200(+)

Full Sequence      

MKAFRSYFTPTRAAVERDDGRATRKSNEDDKLPEQQREKPSGLGSPGSPSSPATYDGSAA
VTPRSITPSPMPGGMLAVPGTAHHGSRKQNGRLTPSTAGSTKRSTAGSYSFRHSIFPAGD
VRNSDSGVVAKVRNDMMVNSLFEQMCRKQYSTGVDPYEGVVLKESRGNFICYPPQMAAIP
ESLYAMITQMNVRCAMTINTHVVRTILNGISRRGGDINFVPLPDGLRVQILRTMSDLPKS
QLHQFAAFIDDAKILVVWADEPEKILSWAEDLEKKLIELIWSTNNDADDEEADEKGNVTT
NVQEVDGNVLEQANEQRPVRLESAFIVALTMALCVACLGLGWRALAYEASVDGTYIRFAL
LAVSPIQLFVSLFFFQTLAGNLFQVFGPISSIDNNSKYYSGKPPQRLDRHLHTLPHVTFQ
MPVYKEGLAAVIKPTVVSVKQAISTYEMQGGTANIFVNDDGMQLISDEEAQARRDFYDEH
NIGWVARPPHNPKPNLEDGETVFLRRGKFKKASNMNYALHTSNRVEEKLSTINRISNWTN
DHETAAYQQCLNEVLREDEGRTWAEGNIRVGDYILLIDSDTRVPSDCLLDAVSEMEQSPE
VAILQFASGVMNVSDSFFEGGVTWFTNLIYTAITFAVACGDSCPFVGHNAMLRWQSLQDA
ASYEEDGYEKYWSESHVSEDFDMSLRLQCAGYSLRYASYTGEGFKEGVSLTVYDELARWE
KYAYGCNELLFHPIRFWVIRGPFTPLFRKFLGSSIALPKKLTICAYIGTYYAIAAAWSLS
LMNYFLTGWFEGFYDKYYLDSFAIYCSIIVVFTALGNFSLAVLRYRTNKQNLLTGLIDNL
KWIPMFTIFLGGISIHITQAILCHFFEIDMVWGATAKEVEEVHFGQEIVRILKRFKFTFL
YCFLMTGLIVAGWFFFPHPWKIQKLYSVYPLASMAVTHFTLPVLLNPALMMFTW

Enzyme Prediction     

No EC number prediction in SMAC_04376-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	573	799	1.8e-50	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.74e-48	573	779	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	8.88e-13	571	880	138	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133029	GT_2_like_c	9.74e-09	553	697	52	157	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
133045	CESA_like	2.14e-08	421	680	3	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133034	Glucan_BSP_MdoH	3.60e-06	572	718	97	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD36996.1|GT0	0.0	1	954	1	953
EAA31611.3|GT0	0.0	71	954	1	877
AEO63469.1|GT0	0.0	1	954	1	981
VBB76138.1|GT0	0.0	1	954	1	941
AEO56958.1|GT0	0.0	39	954	50	956

PDB Hits     

SMAC_04376-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0RNI5|OPGH_XANCB	6.02e-06	571	725	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
sp|Q4UYZ8|OPGH_XANC8	6.02e-06	571	725	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1
sp|Q8P532|OPGH_XANCP	6.02e-06	571	725	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=opgH PE=3 SV=1
sp|Q83Z42|OPGH_XANEU	7.90e-06	571	725	236	392	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas euvesicatoria OX=456327 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000002

TMHMM  Annotations     

Start	End
324	346
358	380
766	788
801	823
843	865
897	916
931	953