CAZyme Information: SMAC_04107-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_04107-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247	NW_003546185|CGC1	26350.22	9.4441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546185:128439-129182(-)

Full Sequence      

MKSFVALSLAALALANPIPVSNEPAILAERQTQTGITSTEFTRLGCRPVIFLFARGSTEI
GNMGSTVGPPTSNGIKAAQGVTNVVTEGIDYPALLSTNFLPGGADLGGISEMKRLLNKAA
TECPNSKIVVSGYRYGHDILASPQFSPLNTHTNRNKKTAKAQPSSDRAVESMSEAVKNKI
VAAVTYGDTQRLQDRGRIPNFPEEKTLIICNTGDLVCVGQLTILAPHLDYKRRVPEALAF
INARLAA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	46	245	1.1e-32	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.79e-43	46	245	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX52366.1|CE5	2.24e-85	1	247	1	222
UQC73970.1|CE5	2.36e-70	7	245	8	224
QDS69670.1|CE5	3.61e-70	3	230	4	197
QBZ62508.1|CE5	1.48e-66	1	247	1	221
UQC79563.1|CE5	2.05e-58	1	247	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CUW_A	1.71e-40	18	230	1	191	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]
5X88_A	3.14e-40	46	246	23	199	Chain A, cutinase [Malbranchea cinnamomea]
1CUV_A	4.79e-40	18	230	1	191	Chain A, CUTINASE [Fusarium vanettenii]
4OYY_A	5.43e-40	46	247	17	194	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1AGY_A	1.28e-39	46	230	17	177	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MZV6|CUTI2_MAGO7	2.43e-51	26	245	21	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q0CRP4|CUTI5_ASPTN	1.48e-48	10	246	13	219	Probable cutinase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_03640 PE=3 SV=1
sp|B8NCM8|CUTI3_ASPFN	2.65e-47	1	245	4	221	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_039350 PE=3 SV=1
sp|Q2U199|CUTI3_ASPOR	1.06e-46	1	245	4	221	Probable cutinase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000113 PE=3 SV=1
sp|Q5B2C1|CUTI1_EMENI	2.74e-44	1	245	3	213	Cutinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999755	CS pos: 30-31. Pr: 0.6693

TMHMM  Annotations     

There is no transmembrane helices in SMAC_04107-t26_1-p1.