CAZyme Information: SMAC_03884-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03884-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	NW_003546203|CGC2	69085.44	5.3786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546203:650147-652310(+)

Full Sequence      

MYPKTAAFLAGALTLTLTQVHMVTATPFPQPQPQPQQKHIGTVDSSSAAASSQAESVSNQ
GRRDAVKQAFRISWDGYYKYAFPHDSLKPVSNSWEDDRNGWGASAIDAFSTALVMRDWPV
VSQILSYVPKIDFTTTSTEISLFETTIRYLGGLLSAYDLLMSPPLVSDPDFNFTSKQTDA
ILSQAISLADALSVAFDTPSGIPDNVLVFDPKTGPRRVGQKTNGIATIGTLVLEWTRLSD
LTGNSTYARLAQRAESFLLNPQPKAIAEPFPGLLGTNVDISTGLFVDSSGGWGGGTDSFY
EYLIKMYLYDPDRFSLYRDRWTLAADSSIKYIASHPSTRPDLTFLGGWRNKTLRFSSGHL
DCFDGGNFILGGLTLSSSKYLEFGLELVKSCAETYSSTTTGIGPELFSWQDSRTPLNASN
NPVPPSAEKKAFYEENGFWITNGQYVLRPEVIESMYYAWRATGDEKYREWAWAAFLAVNE
TTSVEDRGYSSVDNVNERGGGSKTDFQESFWFAEVLKYCWLIFQDEDDPWQVKSDRTNQF
VYNTECHPLRLAKGRETQPSSSSSGSGSSSGSGSGYGSGGDRGGKNNGHGHHQGGHQEGQ
GVWRYGDDDGYGNGKGREKKRFSGPRHA

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	69	550	3.1e-133	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	69	551	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.07e-98	59	553	69	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP66683.1|GH47	9.13e-241	62	556	63	548
CDP28418.1|GH47	9.13e-241	62	556	63	548
AEO64117.1|GH47	1.30e-240	45	556	19	524
VBB80036.1|GH47	8.27e-239	62	556	62	547
AEO58874.1|GH47	1.18e-237	57	555	34	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.53e-187	58	553	1	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.88e-187	53	553	31	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.00e-174	59	551	12	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1NXC_A	2.06e-57	62	558	20	472	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	2.34e-57	62	553	22	469	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QAS2|MNS1B_ASPNC	1.64e-198	60	552	40	511	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	5.35e-197	54	552	34	511	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A1CP08|MNS1B_ASPCL	3.69e-189	62	551	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	9.69e-187	53	553	31	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q0D076|MNS1B_ASPTN	2.01e-185	60	551	37	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000760	0.999211	CS pos: 25-26. Pr: 0.9722

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03884-t26_1-p1.