CAZyme Information: SMAC_03818-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03818-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		65646.95	4.4561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546203:360342-362267(+)

Full Sequence      

MATAVPLAGLEQSYDYVIVGGGTAGCVLANRLTEDKDVRVLLLEAGGDKTTDPVVLTPGL
VSGVYGKDEYDWNFESVPQSTLNNRIVNQARGKMLGGSSGINFMMLVYPSKASIDAWAAV
GNPTWDYEALKPYLKKFATVDVPSASTKEITHITYNNDTVAYGDGPVQISFGEGYGITNE
GWFDTFESLELLSKTDQRDGEALGAFQNANSIDPATNTRSFSAVAYLTAEVRARENLKIL
TNTHVNKVLFDTTGSEPVATGVEINVNGTVSQVSANLEVILSAGALQSPQILELSGVGST
EILSQHSIPVVVENPAVGEGMQDHPIVCQSFEVNEGTPSGDIMRDPAVVEALMAMYAADR
SGPMGQLTISCAYTPLVNKTGVVSEQCIQDLFAGRDFSDPARAAVRDIVSDPNDPTFQYI
LFPTQVHIPDHPESMASHLIPVEPENFLTIMTILNSPFSRGSVHIASADPKAAPVWDPKY
NHDELDMELLARGVQFVESLVAPNTALGKLLNQTGRRLPQLKGDDLETAKEIVRERQISV
FHVSGSCAMRPREQGGVVNERLQVYGAKGLRVVDASIFPVEPSGNIQSVVYSVAERAADL
IKEDRAAGKV

Enzyme Prediction     

No EC number prediction in SMAC_03818-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	604	1.6e-174	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.36e-98	11	602	3	532	choline dehydrogenase; Validated
225186	BetA	6.67e-87	13	607	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.27e-32	457	597	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.10e-32	1	590	43	565	Protein HOTHEAD
366272	GMC_oxred_N	4.01e-25	80	326	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD60572.1|AA3_2	4.78e-283	10	605	6	605
CDP29465.1|AA3_2	4.78e-283	10	605	6	605
VBB81258.1|AA3_2	1.11e-281	10	605	6	605
AEO60130.1|AA3_2	1.62e-272	10	606	7	609
UKZ84858.1|AA3_2	7.76e-235	13	605	7	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.34e-69	13	604	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.56e-65	14	605	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.66e-64	14	605	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	6.50e-62	10	608	2	590	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.17e-59	10	604	32	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.90e-94	10	604	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	2.37e-91	1	609	1	616	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.37e-91	1	609	1	616	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.62e-81	2	604	28	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.19e-76	12	601	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000030

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03818-t26_1-p1.