CAZyme Information: SMAC_03724-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03724-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522		54838.49	5.4036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546203:19340-20968(+)

Full Sequence      

MLAKFAALAALVASANAQAVCSLTAETHPSLNWSKCTSSGCTNVAGSVTIDANWRWTHTL
SGSTNCYNGNKWDTTICSTNTDCATKCCVDGAEYSSTYGIQTSGNSLSLQFVTKGQYSTN
IGSRTYLMNGNDAYQGFELLGNEFTFDVDVSGTGCGLNGALYFVSMDLDGGKSKYSTNKA
GAKYGTGYCDAQCPRDLKYINGVGNVEGWSSSTNDPNAGIGNHGTCCSEMDIWEANKVST
AFTPHPCTTIDQHMCEGNSCGGTYSTDRYGGTCDADGCDFNSYRMGNTTFYGEGKTVDTR
SKFTVVTQFIKNSAGDLGEIKRFYVQNGKVIENSQSNIAGVSGNSITQSFCDAQKTAFGD
VGDFNVKGGLKQMGKALAKPMVLVMSIWDDHAANMLWLDSTYPVEGGSPGAYRGECPTTS
GVPAEVEANAPNSKVIFSNIKFGPIGSTFSGGSSGGTPSNPSSSVKPVTSTAKPTTTSTA
SNPSGTGAAHWAQCGGIGFNGPTTCQSPYTCQKINDYYSQCL

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	20	449	5.7e-191	0.9927710843373494
CBM1	490	518	4.1e-16	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	25	443	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	20	445	1	431	Glycosyl hydrolase family 7.
197593	fCBD	1.69e-13	489	522	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.49e-11	490	518	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA33262.1|CBM1|GH7|3.2.1.176	0.0	1	522	1	521
AGV05127.1|CBM1|GH7	2.53e-282	4	522	5	526
AEO55544.1|CBM1|GH7	1.69e-280	1	522	1	526
ACH15004.1|CBM1|GH7|3.2.1.176	1.61e-278	1	522	1	526
AAQ38146.1|CBM1|GH7|3.2.1.176	1.61e-278	1	522	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W11_A	5.31e-252	21	451	4	436	Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus],5W11_B Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus]
4CSI_A	9.79e-250	21	451	4	436	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
4V1Z_A	5.52e-209	25	452	8	440	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
1Q9H_A	1.21e-197	24	449	7	434	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
5O59_A	7.64e-197	20	448	3	429	Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O59_B Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O5D_A Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O5D_B Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SA23|GUX1A_NEUCR	0.0	1	522	1	521	Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cbh-1 PE=3 SV=1
sp|P15828|GUX1_HUMGT	9.09e-271	3	522	4	525	Exoglucanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=CBH-1 PE=1 SV=2
sp|P38676|GUX1B_NEUCR	2.12e-255	1	522	1	516	Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cbh-1 PE=3 SV=1
sp|P46238|GUXC_FUSOX	1.77e-251	10	521	10	513	Putative exoglucanase type C OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q4WM08|CBHB_ASPFU	2.04e-233	8	522	17	532	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999753	CS pos: 19-20. Pr: 0.5387

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03724-t26_1-p1.