CAZyme Information: SMAC_03722-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03722-t26_1-p1
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	NW_003546203|CGC3	51398.22	7.3049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546203:7981-9441(-)

Full Sequence      

MIAKLVSPLGSPKLAATTAQFRSFTDPIPARRASLYRRVQDTTFVLPHVPTKHNVPKYTR
AEFPRKIWQTWKVNPLAFEQRDLDTARSWVGKNPSYRYEVLTDGNDMQYVEWHFGPDGFN
RPDIVNFYRSVKAAIVKADLLRYLVMYAEGGLYADIDVEALKPLSKFVPERYDEGDIDMV
IGVEIDEPDWKDHPILGPKSRSFCQWTFMCKPQLPVMMRLIEQIMTWLSGVAKEQGVPLA
EVKLDFDQIISGTGPSAFTNAIIAEMNELNDNTGRPITWDAFHDLGESKLVSRVLVLTVE
AFAAGQGHSNSGNHDARAALVKHHYHASNWPSRHPRYKHPAYGEVEQCNWVDECVKKWDE
NVAAWSKLSEVEQKSILAEKERKEKEREEQRKKEEEDRKKKEEEDRKKKEEEDKRKKEEE
EAKAAKEKAAKEKNAGKGGEKAAKDNKS

Enzyme Prediction     

No EC number prediction in SMAC_03722-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	84	169	8e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.81e-19	56	228	75	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.39e-11	81	170	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84288.1|GT32	1.68e-213	1	386	1	420
CDP31064.1|GT32	3.12e-211	1	386	151	570
CAP71672.1|GT32	3.12e-211	1	386	151	570
AEO66402.1|GT32	4.35e-206	1	386	1	398
AEO60901.1|GT32	2.62e-202	1	380	1	392

PDB Hits     

SMAC_03722-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.82e-34	45	330	126	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.05e-30	31	302	94	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.54e-29	63	323	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.66e-23	56	323	89	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.73e-08	53	217	47	203	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03722-t26_1-p1.