CAZyme Information: SMAC_03653-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03653-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		67841.76	6.5068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546233:628734-630560(-)

Full Sequence      

MKVLLLQRPTRGFSIFVTIIFVVVLWSIARLRRHGSLLPSTFDNWGGRGEWKGQGEGGGG
GGGNLPSGGGTPADQTTLQASQLPYRPQLDPGQCPKDIEYLRRPELGLTDNILYSRRCIK
PVYKANFDRNAITNIPGPLVTNTTALDLTSCSHDDDPIPCEPLSLEVPMPYPKDAQYQNL
IFGVASKYERMHEAIPAFAHWLAGTGARLVGTIADAVPPEHQDDDSTKHSFNLTLLEEEY
RAAGIVATFLPPKIFKRLNLKDGKPDPRPVPIEHHHFLLIKELLSVIDSDEKTSSHWLAI
LDDDTFFPSLHPLSTTLSQHDHTRPLWLGALSDDFMAVQAWGFMAFGGAGSFLSLPLARQ
LAPHLEECITTASIQTGDGILRDCVYSHTRTRLTLVEGLNQHDIKGDASGIFESGVWPVL
SLHHWKSWYEAPVEKMARVARDVCGDCFLMRVRFGTEEKDKKKKKQEESLLSLGYSTTSY
PGLENGLDDVDLSRVEGTWNEAERKEKYAFSYGPVRRRLQEGKEKKSWRLVDVDVDEEHS
SSSSSLWSSPPESQSTVTRQQSEGKKETSGWTASKKGKKRFRQIYVHKAAGPAVGESMDE
VIELVWEI

Enzyme Prediction     

No EC number prediction in SMAC_03653-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.51e-10	297	424	213	341	hypothetical protein; Provisional
367085	Fringe	8.85e-08	297	402	87	204	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	6.56e-07	344	424	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60093.1|GT31	3.04e-144	94	608	91	539
AEO67880.1|GT31	2.40e-139	94	607	54	512
QBZ53356.1|GT31	9.78e-117	91	607	81	510
CCT63554.1|GT31	4.10e-100	84	608	43	494
QGI77030.1|GT31	4.10e-100	84	608	43	494

PDB Hits     

SMAC_03653-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SMAC_03653-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

Start	End
12	29