CAZyme Information: SMAC_03480-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03480-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743		78569.04	6.4878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546240:913827-916546(+)

Full Sequence      

MRFGTLLLAVASLTSAVNAYWMGDIAHRGYAPFAYSGYPVFRNVRDYGAKGDGVTDDTIA
INAAITTGNPCNQGCASTTTTPAVVYFPAGTYLISGSIKPAYFTQLIGDAGSPPTLKATA
NFAGLIRNFVIDTTNIPAGNAATGIHWPTSQATSLQNIVFNMPTASNVVHVGLFMEEGSG
GFVTDLTFNGGATGASMGNQQFTMRNLKFNNCKTAIYHLWNWGWTYSGLSINNCGIGIDM
TAGSGKVETGSITVFDSSFTNTPVAISTSWTTTTTPDTAGTLVLENIALTNVPVAVKGPQ
GTYLSGSTGSTTITAWGNGHKYTPSGPVEFAGAITPNPRPVSLLASSGRYYTRSKPQYET
LSASQFISARDSGAKGDAATDDTAALQRAINTAVAQGKVLYLDYGLYRVTSTIRIPPGAK
IVGESYATIMSAGGFFNDMNNPKPVLQVGSYSGQAGTVELTDFIVSTQNAQAGAVLIEWN
LASPASSPSGMWDVHTRIGGFVGSQQQVGECLKTPGNPTVRRECIVAFMAMHITKGASGL
YMENVWLWTADHDIDDAALTQITLYSGRGLYMESTSGTFWLYGTGSEHHVLYQYQLSSTQ
NIFMGMIQTETPYYQPTPNALVPFPTVSSLNDPNFASSCSGVSGNCAAAWGLRVLNSKNI
LVYGAGLYSFFSDYSTTCSTFAAGQTCQSRIASIEGSGCSNVNIYGLNTIGAQSMLTRNG
QSVAWYADNVNNFPSSIGVFKSG

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	118	740	6.4e-231	0.8081081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	4.38e-86	41	239	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	8.70e-12	366	435	1	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	7.78e-06	43	143	84	172	Polygalacturonase [Carbohydrate transport and metabolism].
215120	PLN02188	5.69e-04	35	99	31	85	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA31173.2|GH55	0.0	1	743	1	767
AEO64347.1|GH55	0.0	26	743	25	764
AEO59077.1|GH55	0.0	7	742	8	762
VBB79880.1|GH55	0.0	1	742	1	769
CDP28262.1|GH55	0.0	1	742	1	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	3.65e-217	16	742	2	755	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.09e-202	18	737	24	752	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	2.44e-230	9	743	37	787	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	3.00e-204	18	743	41	876	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.98e-62	13	725	30	750	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999765	CS pos: 19-20. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03480-t26_1-p1.