CAZyme Information: SMAC_03434-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03434-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		57233.36	5.9450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546240:702455-704294(-)

Full Sequence      

MKKLILILILSGITASLARKKHRLQPQDQQPWELSEESTCPDYSYYAYQKHPPYSSGKYQ
LPYQRPVPACRKFNLTEVEDTISDMKQIIRDPDLFRLFENCFPNTLDTAIAWKGIAAKGH
GDEHYREDDYEEELTFITTGDIPALWLRDSSNQLLSYLPLLRPSSYSSNTSLASLYRGLI
NLQARYILTSPHCNAFHAPPESNLSLSLNPSTSTDTGTGTTDYVYPSPDPSTVFECKYEL
DSLASFLHLSHAYHNATGDTLFFSCARNWVKAVDLILNVTAELQAGTYKEDGSVAFSPYQ
FQRSTSTASETLGNAGAGNPVRNGTGMVRSAFRPSDDACNYQLFVPGNMMYSTALERVAE
GIVARIEGQVEKSARLKRMREMAQGIKRGVEKFGRAEHWRYGRVYAYEVDGFGSHSMMDD
ANIPSLLSAPLFGYVDRNDPIYQNTRRFVLSRENPYYMVGPVLIVQIMTSDDDAEIVNCL
QQILSSTDGLGLMHESISSKSASIWTRQW

Enzyme Prediction     

No EC number prediction in SMAC_03434-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	91	509	1.8e-132	0.9651741293532339

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	91	509	1	403	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.96e-134	69	509	1	407	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP28302.1|GH125	4.04e-180	36	509	29	533
VBB79922.1|GH125	4.77e-174	36	509	29	524
CCD45801.1|GH125	1.20e-165	37	509	20	485
ATZ46083.1|GH125	1.20e-165	37	509	20	485
APA07134.1|GH125	8.96e-163	40	509	23	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	2.23e-73	65	509	21	435	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	8.53e-73	65	509	43	453	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	6.70e-71	65	509	23	433	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	2.20e-64	83	509	17	407	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	2.69e-64	83	509	17	407	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	5.85e-118	31	509	23	481	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000312	0.999675	CS pos: 18-19. Pr: 0.9739

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03434-t26_1-p1.