CAZyme Information: SMAC_03202-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_03202-t26_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		64821.44	7.4364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546222:742702-744759(-)

Full Sequence      

MKFTSTLALGLSVVVDGTLGAKIPQGPKTTCPPGASFKKLSAQAFMDAATPGWNLGNTLD
AVPDEGSWNNPIFQANALDVVKSAGFKSVRIPVTYSDHFLLPNSLTNHTISPQWLDRVST
VIDMATSRGLLVVTNMHHDSWAWADVSSSGGKNTTLIREKFYAGWLQIATKLACKPSTVA
FEPINEPPGSTAEDAERLMGLNDLFIHALRDSGGWNSQRVVTLSALNMGGADRMQNGWFR
LPKNMTNPWAFQFHYYSPYDFIFQAWGKTVWGSESDKVAVVADLEAVRGNLTAITNDPKV
PIYLGEFDASQLSLEAAARWRWFDTVVSAARRLNIVPVLWDNGLDNLQRETGRWRDEVAV
EIIVNAIKGKKNSLPESTTDGGATTQESSAYVFNKVGEDIGAEGRNLSFALNGNRFKALS
VGGVPLKAGKDYAVQEQGTVTLKKEFLGKYLSRDAAPGTKANITVTFSAGAKSRVEIVQW
DLPVPAQTISSGSAVPAGQDLSVPVVWKGLHRVAAVKMIKADGSYLFDDWTMWLPGLQKG
CGTYGGQWDFDFDKLIIRRQTLDAVIASGQSATLTFEFYPRAAGNGNYLNYTLTV

Enzyme Prediction     

EC	3.2.1.-:12	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	343	1.2e-61	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.39e-29	65	343	16	269	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.43e-16	47	307	49	321	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
397483	CBM_X2	4.67e-16	386	477	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87183.1|CBM1|GH5_4	4.14e-199	29	593	102	648
AFG25592.1|CBM1|GH5_4|3.2.1.4	6.75e-186	36	595	109	655
AIO06743.1|CBM1|GH5_4	6.75e-186	36	595	109	655
EAA59690.1|GH5_4	9.81e-186	28	595	20	572
CAE7206214.1|GH5_4	8.76e-185	30	595	27	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YZP_A	1.72e-83	20	581	1	524	Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
5E0C_A	1.39e-47	38	531	6	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
5XRC_A	2.95e-47	38	531	39	510	A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_B A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10],5XRC_C A Trimodular GH5_4 Subfamily Endoglucanase Structure with Large Unit Cell [Bacillus sp. BG-CS10]
5E09_A	1.79e-46	38	531	6	477	Structural Insight of a Trimodular Halophilic Cellulase with a Family 46 Carbohydrate-Binding Module [Bacillus sp. BG-CS10]
4V2X_A	7.45e-45	38	593	54	574	Chain A, Endo-beta-1,4-glucanase (cellulase B) [Halalkalibacterium halodurans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23550|GUNB_PAELA	6.05e-47	4	593	6	554	Endoglucanase B OS=Paenibacillus lautus OX=1401 GN=celB PE=3 SV=1
sp|O08342|GUNA_PAEBA	2.43e-36	35	367	33	395	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
sp|P16218|GUNH_ACET2	7.36e-32	29	344	316	602	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1
sp|P28621|GUNB_CLOC7	6.28e-31	37	343	37	341	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
sp|P54937|GUNA_CLOLO	3.92e-30	41	385	38	393	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999783	CS pos: 20-21. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in SMAC_03202-t26_1-p1.