CAZyme Information: SMAC_02192-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_02192-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		71780.93	7.0967

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546226:665493-667412(-)

Full Sequence      

MRSRQLLILVGTVFIFFCIYSLFTSSSSLSQGQQKLKDTYKNGAHHLPHDNIDFKSKPAA
VRPPKPAPKGSHPIWHLTIDAERDLEAMKARQSRTLKEAVKEYRRRYGLPPPPNFDKWWA
FAKEHDVQLVDEFDMIHELITPFWGLSPRTVRMRAKEALGFDGNALIGLQIRDGEIAYVR
GGQEWQVEATKGMMKKFKQWLPDMDLAFNIHDEPRVVVPAEDMARLIGRAKNVNMPAANK
GSAYRNDFTRDPDGGLSPTGSFSEEKFTRFNVFAHQPTWTHSRMSCPADSPARLIDEEGA
DKPQRLDDVSKFGLGELGFVYNWTAMSDVCLSPSLSTTFGFFDRPNAYNVVHDLFPIFSQ
SKISSYADILYPSPWYWYEKVPYEESKDPLWDDKTNQLYWRGSTTGGFSRNGGWRRQHRQ
RFVQKINERDTAKVLVNQGKNEQNPDWVVSEVSRSDYRDIVNVFFSHIGQCDPGDCDAQR
EFFEVKSYAEQGDAFKYKHVLDIDGNAFSGRFYAFLKSRSLVYKWAIFREWHYEWLKPWA
HFIPLSTQGEDWLETVRFFSEESATVSQGTKEAERVAIQGREWANKVLRHEDMEVWFFRL
LLEYGRVIDDNRENIGFLP

Enzyme Prediction     

No EC number prediction in SMAC_02192-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	608	1.4e-82	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.77e-19	352	606	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.80e-09	356	606	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28085.1|GT90	0.0	1	619	1	619
UQC78507.1|GT90	6.61e-288	1	617	1	608
UNI14246.1|GT90	8.51e-278	1	619	10	625
CDP32535.1|GT90	1.08e-268	1	617	1	611
VBB87010.1|GT90	3.07e-268	1	617	1	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.30e-07	293	611	67	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.89e-06	356	608	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.14e-45	71	614	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	7.78e-08	493	607	358	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	8.22e-08	348	608	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.03e-07	493	607	358	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.25e-07	333	611	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996692	0.003339

TMHMM  Annotations     

Start	End
7	29