CAZyme Information: SMAC_01645-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_01645-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	NW_003546238|CGC3	85308.29	4.7518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546238:1633127-1635454(+)

Full Sequence      

MAFSQAFSSRRGRIFALTAFLALVILLVGYQTASPLSIYRQDPVVLKQPEHQETGSKAGH
GDLTPPPLETWNHHEQQDTGGVPANHDDVSLNPPTTPSGEEEDIDLGLGMGLGTGTVDVG
GEEQANGPDETLEVSPVTSSTPAEGEEECVRFEQLQRKKPGPLSAGKRQFPYVRPPPHCR
TFQLPALEKLIERMRTVIKDPDLFRLFENSYPNTLDTMIKWHGYARNNSPWDTNTGTYSK
SLAAFMATPDGVEQQEEVDNPETDEELTYIITGDIDAMWLRDSASQLYSYLPFLTPSTSK
DSLASLWRGLINSHARYIVISPYCHSFQPPPESGIPPTHNGAYNQNNPQPPYDPQKVFDC
KWELDSLASFLQISSAYHAKVPKDLAFFGKYKWIEAVQAAVDAAAAMRLGTYDEEGKVLP
SAWTFTGWTNRGSETLTNDGLGNPVKENGMVRSGFRPSDDACIFQLLTPSNMMFAAYLEQ
ASVIMEGLSSLDGLDQAKKTMAKNMTARMRDLARGIRYGIAQDAVVTHREFGEIFAYEVD
GYGSANLMDDANVPSLLAFPLWNYTHPPPSLGDHDHEQTKTMVKSTHGGSKTPSRSSDST
QVQPPSVDDETELPPASPPPPPKPYTTTPLPSHNYSAIYQNTRRFILSLSNPYFAKGPAL
SAVGGPHLGPGKGWPMAATVAALTAYNLDLSGLSSGSKEQERAVEEQLKMILDSTSGTGV
VHETVNAWNEKDWTRSWFGWANGLFGELIMRIAEEEAGREVKWEEGEGLLGRSWQ

Enzyme Prediction     

EC	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	200	750	8.9e-167	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	200	750	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.96e-109	179	754	2	424	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA36038.1|GH125	0.0	1	775	1	752
VBB72383.1|GH125	2.31e-296	9	775	9	701
CAP69265.1|GH125	1.33e-295	9	775	9	701
CDP23284.1|GH125	1.33e-295	9	775	9	701
AEO70287.1|GH125	1.93e-279	9	775	9	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	4.84e-66	180	755	27	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.25e-64	174	755	43	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	8.08e-62	174	755	23	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	2.01e-51	262	749	45	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	1.18e-50	262	749	45	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.99e-90	149	756	27	500	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000014

TMHMM  Annotations     

Start	End
12	34