CAZyme Information: SMAC_01297-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_01297-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	NW_003546238|CGC6	42169.91	6.5053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546238:343724-344914(-)

Full Sequence      

MLTFRRALVAAAFFLTVFYLISSSSSNPPSVTTPAIPKADADVEAAKHASTTAVTDKSPS
GHNSAQQNPQGQRPIQDMSRMTLYEKLAYQFPYDVESKFPAYIWQTWKWTPAHSEFTFRD
QEATWTQQHPGFIHEVITDKVAVHLIRLLYTSVPEVVEAYNALPLPVLKADFFRYLILLA
RGGIYSDIDTYAIRSAVEWIPDSVPKDAIGLVIGIEADPDRPDWKEWYSRRIQFCQWTIQ
SKPGHPVLREVVSRITNATLAMKRNGTLRGIIDKNVIEFTGPALWTDVIFEYLNDKRYFD
MTHSAGSIDWKNFTGMEVSKRVGDVVVLPITSFSPGVGQMGAKDYDDPMAFVKHDFEGTW
KPESERHIGENK

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	201	1.9e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.43e-42	73	361	54	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.72e-18	124	203	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB72967.1|GT32	7.51e-204	1	370	1	376
AEO65653.1|GT32	9.27e-201	1	369	1	379
CAP67577.1|GT32	4.37e-194	69	370	75	397
CDP23838.1|GT32	4.37e-194	69	370	75	397
QBZ65877.1|GT32	5.45e-191	1	372	1	377

PDB Hits     

SMAC_01297-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.94e-100	82	361	82	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.99e-77	86	361	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.00e-72	83	369	80	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	6.69e-72	72	361	99	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.835398	0.164619

TMHMM  Annotations     

There is no transmembrane helices in SMAC_01297-t26_1-p1.