CAZyme Information: SMAC_01107-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_01107-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32466.31	4.8596

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546225:1806471-1807472(+)

Full Sequence      

MVRTSLLTYLALGLGSTAVLASKCGVATGSLQPVANFGENPTGLDLQIYVPKNLAPNPAV
ILALHYCGGTGPLYSQQSNYNPLADARRNFVILYPSTTHDNNCWDVASSKSLTRDAGGDT
TSLANMVRWAIDEYDADPSKVFVTGSSSGCMMSNVMAATYPDLFSAVSCYSGVPAGCLAG
SPGASPTTADPTCANGDNRKTGPEWAALLKGMYGTPEGYTEGQYPKVQTWHGEADFFVNY
PNLAEQLKQWSEVLGVSFSKNETDTPQSGYTKIVYGDGSKLVGYSARGVGHTVPVHPEAD
LQWFGL

Enzyme Prediction     

No EC number prediction in SMAC_01107-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	245	2.5e-23	0.7797356828193832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.20e-33	49	265	4	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	8.77e-29	7	294	7	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.04e-19	44	247	1	191	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	8.15e-06	43	173	375	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	8.99e-06	127	173	52	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC91056.1|CE1	1.53e-135	27	306	17	292
CAP71713.1|CE1	1.11e-125	14	306	9	321
CDP31104.1|CE1	1.11e-125	14	306	9	321
VBB84349.1|CE1	1.19e-124	14	306	9	319
CAE7030940.1|CE1	9.57e-116	20	306	11	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.23e-87	28	306	1	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8M9H9|FAEB_TALSN	2.48e-93	26	306	16	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	4.24e-93	26	306	16	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	5.48e-87	20	306	21	302	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	1.10e-86	20	306	21	302	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q92194|AXE1_ASPAW	1.61e-86	28	306	30	303	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999737	CS pos: 21-22. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in SMAC_01107-t26_1-p1.