CAZyme Information: SMAC_01023-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_01023-t26_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	NW_003546225|CGC9	85324.44	6.5893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546225:1506316-1510179(+)

Full Sequence      

MDSHAGFNGALNPEVLTLKVRSLPSPFFSLVVIPILSVLGWYVVSWATNPLKEYPGPFLA
GFTNWWRLYQTRTGRYHEIIYDLHKKYGPIVRIGPNTLDLDYPELIKTIYSTDGKWLKTE
FYENNSAIVNGKITYHIFSTTSPTEHAKMKRPVAKYYSMSYVQALEPHVDVVLNDFCKYV
EERFINVPGGPKELDFGEWLGYHAWDLISSVTFSRRFGYMEHGSDFDGTIEKAEASLRYF
QTVGQIPVLDYLLDKNPVKRVGPPNLINPARIAVESFVARLQGKDENYDPKHPDYLQHFI
DSKETHPDIVDDNQIISDVLVNLLAGADTTAVALRAVFYYMLKNPSVYNKVSEEIQAAGF
DRSKPVPYSGARQLPYLEACVRESLRIHPAAAMLLERYVPAGGITLPDGSFVPAGTAIGL
NPWVVSRNKSIFGEDSDVFRPERWLQQPGEDDETFRVRMQKWNAADLTFGNGSRICTGRN
FAMFELYKVCATLLHRFEIELADPTKEWKVWGSWFTIQKDVIAKMKVRASDRTTGGSGGT
VTTVSTLAQFTAAVSEKNTAPAIVVIKGVISGNEKVRVASNKTIIGLPGSGFNGVGLHFR
RQSNLILRNIISSFVEADNGDGLKIEESSNVWVDHCEFYSALVSDKDFYDGLLDVSHGSE
WVTVSHNGSEDTGHLHVTYANNYWKNCGSRGPLVRFGTAHIYNSYYEKDSKQVGYAVEID
NDFGGASNTAPTGSLTANSPPYSYSLLGSSNVAATVPKQAGAILGF

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	565	713	8.7e-61	0.9116022099447514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410683	CYP57A1-like	0.0	88	521	1	423	cytochrome P450 family 57, subfamily A, polypeptide 1 and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Nectria haematococca cytochrome P450 57A1 (CYP57A1), also called pisatin demethylase, which detoxifies the phytoalexin pisatin; Penicillium aethiopicum P450 monooxygenase gsfF, also called griseofulvin synthesis protein F, which catalyzes the coupling of orcinol and phloroglucinol rings in griseophenone B to form desmethyl-dehydrogriseofulvin A during the biosynthesis of griseofulvin, a spirocyclic fungal natural product used to treat dermatophyte infections; and Penicillium aethiopicum P450 monooxygenase vrtE, also called viridicatumtoxin synthesis protein E, which catalyzes hydroxylation at C5 of the polyketide backbone during the biosynthesis of viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP57A1-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410684	CYP67-like	1.07e-85	88	518	1	413	cytochrome P450 family 67 and similar cytochrome P450s. This subfamily includes Uromyces viciae-fabae cytochrome P450 67 (CYP67), also called planta-induced rust protein 16, Cystobasidium minutum (Rhodotorula minuta) cytochrome P450rm, and other fungal cytochrome P450s. P450rm catalyzes the formation of isobutene and 4-hydroxylation of benzoate. The gene encoding CYP67 is a planta-induced gene that is expressed in haustoria and rust-infected leaves. The CYP67-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410685	CYP58-like	3.06e-79	88	507	1	406	cytochrome P450 family 58-like fungal cytochrome P450s. This group includes Fusarium sporotrichioides cytochrome P450 58 (CYP58, also known as Tri4 and trichodiene oxygenase), and similar fungal proteins. CYP58 catalyzes the oxygenation of trichodiene during the biosynthesis of trichothecenes, which are sesquiterpenoid toxins that act by inhibiting protein biosynthesis. The CYP58-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410682	CYP_fungal	1.14e-73	88	504	1	402	unknown subfamily of fungal cytochrome P450s. This subfamily is composed of uncharacterized fungal cytochrome P450s. Cytochrome P450 (P450, CYP) is a large superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop. Their monooxygenase activity relies on the reductive scission of molecular oxygen bound to the P450 heme iron, and the delivery of two electrons to the heme iron during the catalytic cycle.
410681	CYP60B-like	2.62e-69	88	514	1	412	cytochrome P450 family 60, subfamily B and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Aspergillus nidulans cytochrome P450 60B (CYP60B), also called versicolorin B desaturase, which catalyzes the conversion of versicolorin B to versicolorin A during sterigmatocystin biosynthesis; Fusarium sporotrichioides cytochrome P450 65A1 (CYP65A1), also called isotrichodermin C-15 hydroxylase, which catalyzes the hydroxylation at C-15 of isotricodermin in trichothecene biosynthesis; and Penicillium aethiopicum P450 monooxygenase vrtK, also called viridicatumtoxin synthesis protein K, which catalyzes the spirocyclization of the geranyl moiety of previridicatumtoxin to produce viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP60B-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54996.1|PL1_7	1.21e-106	533	766	50	330
AUT30983.1|PL1_7	5.20e-98	533	766	53	333
CAW70676.1|PL1_7|4.2.2.2	4.00e-97	533	766	53	333
CBC59869.1|PL1_7|4.2.2.2	4.00e-97	533	766	53	333
AAD43564.1|PL1_7|4.2.2.2	4.00e-97	533	766	53	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	4.62e-25	533	723	14	245	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
3K9V_A	1.53e-23	48	503	20	457	Chain A, 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial [Rattus norvegicus],3K9V_B Chain B, 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial [Rattus norvegicus],3K9Y_A Chain A, 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial [Rattus norvegicus],3K9Y_B Chain B, 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial [Rattus norvegicus]
5YLW_A	2.22e-20	77	505	49	466	CYP76AH1 from Salvia miltiorrhiza [Salvia miltiorrhiza],5YM3_A CYP76AH1-4pi from salvia miltiorrhiza [Salvia miltiorrhiza],7CB9_A Chain A, Ferruginol synthase [Salvia miltiorrhiza]
5VCD_A	4.88e-19	82	537	43	483	Crystal structure of the cysteine depleted CYP3A4 bound to glycerol [Homo sapiens],5VCE_A Crystal structure of the cysteine depleted CYP3A4 bound to ritonavir [Homo sapiens],5VCG_A Crystal structure of the cysteine depleted CYP3A4 bound to bromoergocryptine [Homo sapiens]
6WR1_A	5.08e-19	72	503	27	451	Chain A, Steroid 17-alpha-hydroxylase/17,20 lyase [Homo sapiens],6WR1_B Chain B, Steroid 17-alpha-hydroxylase/17,20 lyase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8V0D4|CICH_EMENI	1.67e-94	51	528	25	491	Cytochrome P450 monooxygenase cicH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicH PE=1 SV=1
sp|Q0CRQ3|AZPA3_ASPTN	5.78e-87	51	499	37	480	Cytochrome P450 monooxygenase ATEG_03631 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_03631 PE=1 SV=2
sp|I7LRH3|MPADE_PENBR	3.02e-85	51	533	29	508	Cytochrome P450 monooxygenase mpaDE OS=Penicillium brevicompactum OX=5074 GN=mpaDE PE=1 SV=1
sp|A0A0B5KYT4|MPDE2_PENBR	2.97e-84	51	515	29	487	Cytochrome P450 monooxygenase mpaDE' OS=Penicillium brevicompactum OX=5074 GN=mpaDE' PE=1 SV=1
sp|B8NYW9|FLUA_ASPFN	4.23e-82	51	530	23	497	Cytochrome P450 monooxygenase AFLA_114810 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_114810 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

Start	End
27	49