CAZyme Information: SMAC_00873-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_00873-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	NW_003546225|CGC1	59793.04	10.1976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546225:930602-932257(-)

Full Sequence      

MSLTQRSSRSTLLSASKDADDNSARPRNRRVASNRNDANTSSVYSSPSRTPDRGASPIPA
ARIGDVTGRNNSRLEVAAGSARASSPRGGGGLLDGSWASTWATVSEFTTSLLTGGESYHT
GSERSATRTTGKQKASNSWGPEPPNESRPRLADVGSGSMTEREGLLRALRTASVLESHEG
VNGGLDVSRRFKKRSSDEDLRETSQSQETAEHLVYIHHVQSTDTYAGIVLRYKCREDAFR
KANGLWSRDNIQIRKWLAIPVDACEIKGRPCEGPSFPGAHVDYLARTPEATDPFGRDISN
SREFFGTSPNDQGGDNKLQTNDDERPWTHVRWVSLDSFPDPVEVARVERKVLGYFPPRRR
KSMNTTSTMTSPRTSMDVPGITLSGEAGPGSPGSVSSRRTSLMGSRPNLIEDDARPAWMR
RPGGVGSLRNVRAPGPEKDYFNTWTNKHLPGLNIDTLPSMAVLGAETAHIGFTGGGEHPT
IVESPFEDGGDASTINGQGSTGLDKAAAAVENWLRGAICQAAKWTKNAFSKHTKTVGSGA
RRRRPHRAYRH

Enzyme Prediction     

No EC number prediction in SMAC_00873-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.29e-04	216	259	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	0.003	217	260	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	0.005	216	253	1	38	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB83868.1|CBM50	1.52e-189	1	518	1	540
QBZ56316.1|CBM50	1.36e-163	21	533	15	572
UQC89347.1|CBM50	5.32e-152	8	541	2	565
CEI65780.1|CBM50	1.46e-140	8	520	13	553
QPC76417.1|CBM50	6.51e-139	8	520	13	553

PDB Hits     

SMAC_00873-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CY38|Y2072_EMENI	6.76e-44	47	521	61	530	Uncharacterized protein AN12072 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN12072 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

There is no transmembrane helices in SMAC_00873-t26_1-p1.