CAZyme Information: SMAC_00649-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_00649-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	NW_003546225|CGC10	57675.91	5.0829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546225:82552-84263(+)

Full Sequence      

MLPPLLFWLSSDVVQARRVAASTCPAPVPASYPAPVVRDGYEARLVATGLKRPRGVIVDS
KGRLLVVESGKGITHLTIKDDGWPCLSVEKTTTLVSMSDLNHGIELSVDGKTLYASTSNS
VYSWAYDAEAVSVSDEKSPKTLISNMTNVGGGHSTRTLLLSRKQPGILLVSRGSGSNLDN
GATDHSSGISQIRAFDISDPNLSTSGGGGGKVYDYPSEGWTIGWGLRNSVGVAEEPNTGG
IYSVENSADGIRRFDVDIHEDSPGEEMNYHGVLRVPSSSSSSDTTQGQGGGNHGYPYCLA
LYNSSTPSPFPSLGNLKTGSQFTHDSTPYSIPFLPSSSDSSSVPQAKPINITASDTSCSS
ANFVPPRLTFPAHTAPLDIKFSNKNNNRTLAYITFHGSWDRSTPAGYKLSAVRFDVTKGE
PVEASDSTNSLVDVMWNRDVTKCPDQCFRPVGLAVDDREGRIWMTDDDKGDVWVLKQVGE
VKGDNDDDDDGNGGVGSGSGSANGDSDSAAVPMRMKRNGSGSEWMGVGRSMVVAVVGSVL
FAVL

Enzyme Prediction     

No EC number prediction in SMAC_00649-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	27	475	2.5e-157	0.9900249376558603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.67e-13	25	472	41	390	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
380207	ScyE_fam	0.007	46	72	3	29	ScyD/ScyE family protein. This family includes ScyE, a protein involved in scytomenin biosynthesis and export, and its paralog ScyD. Some members of the family contain a C-terminal PEP-CTERM domain that predictions anchoring to the outer membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28445.3|AA12	6.33e-296	1	544	12	556
AEO64217.1|AA12	2.39e-132	22	480	36	457
QYT00796.1|AA12	2.62e-132	5	483	7	433
QKD50391.1|AA12	3.11e-131	31	477	30	431
UKZ85601.1|AA12	2.65e-130	12	477	18	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	1.57e-114	31	477	7	402	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.62e-114	31	477	8	403	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.67e-114	31	477	9	404	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	3.48e-51	37	477	17	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

SMAC_00649-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.946480	0.053539

TMHMM  Annotations     

There is no transmembrane helices in SMAC_00649-t26_1-p1.